KEGG   Nostoc sp. PCC 7107: Nos7107_5435Help
Entry
Nos7107_5435      CDS       T02362                                 

Definition
(GenBank) hypothetical protein
Organism
nos  Nostoc sp. PCC 7107
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHA_synth_III_E Dynamin_M Herpes_UL92
Motif
Other DBs
NCBI-ProteinID: AFY45917
UniProt: K9QM96
Position
complement(6316709..6317104)
Genome map
AA seq 131 aa AA seqDB search
MEEWHKDLMGIVETVAEEVERFFQGMNDMVDSFFDLTEELTEEVQNSIAIEVEQYLQEIS
APFLEMYWELEDIVTDADPGFPYSVEATPEQNAACVGCTNYHGQVYGGNLLVCAMHPQGW
DDQNCPDWEQE
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atggaagaatggcacaaagatttaatgggaatcgttgaaacagtggcagaggaagtagag
cgcttctttcaaggaatgaatgatatggttgatagcttttttgacctgacagaagaatta
actgaggaagtacaaaatagtattgccattgaagtagaacaatacttacaggaaatatct
gcacccttcttagaaatgtattgggaactagaagatatagttacagatgcagatccaggt
tttccctactcagttgaagctacaccagaacaaaatgctgcttgtgtaggttgtacaaac
taccacggtcaagtttatggtggtaacttgttagtctgtgctatgcacccccaaggctgg
gatgatcagaattgtcctgactgggaacaagagtag

DBGET integrated database retrieval system