KEGG   Nostoc sp. PCC 7107: Nos7107_5438Help
Entry
Nos7107_5438      CDS       T02362                                 

Definition
(GenBank) signal peptide peptidase A
  KO
K04773  protease IV [EC:3.4.21.-]
Organism
nos  Nostoc sp. PCC 7107
Brite
KEGG Orthology (KO) [BR:nos00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:nos01002]
    Nos7107_5438
Enzymes [BR:nos01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     Nos7107_5438
Peptidases [BR:nos01002]
 Serine Peptidases
  Family S49: protease IV family
   Nos7107_5438
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S49 CLP_protease SDH_sah AvrRpt-cleavage
Motif
Other DBs
NCBI-ProteinID: AFY45920
UniProt: K9QJX1
Position
complement(6318206..6320038)
Genome map
AA seq 610 aa AA seqDB search
MNNFLKQTVASLIGSLLGLFIFCGISTTGLLLLLFAIAASQDVSPVVKDKSVVVFDLSMN
ITDREPSAGEELQRTLSGNPEDRITLRKVLEAIEKAKQDPKIVGIYLDGTKTTGSNLGFA
SLKEIRKALEEFRAAGKKVVAYGQDWGKKEYYLSSVADTIALNPLGAIEVNGLSSQQMFL
TGALQKFGIGVQVVRVGKFKGAVEPLILNKLSPENREQTQKLLDDVWSEWRTTVGTSRKI
NPQKLQAIADNQAIVEAPVAKTNGLVDKVAYHDQVVADLKQLTGSEQNDKTFRQVDLLEY
SQVINKSSSAARESNNKIAVVYAEGEIVDGSGDDEQVGGDRFAKIFNKIRQDKNIKAVVL
RINSPGGSATAAEVMQREVRLTHDIKPVVVSMGDVAASGGYWIASDSSRIFAEPNTITGS
IGVFGILFNGQKLANDNGITWDVVKTARYADNQTVSRPKSPQELALYQRSVNRIYSLFLN
KVSQGRKLPAQKVAEIAQGRIWSGVAAKQIGLVDEIGGLNAAVQYAAKKANLGNNWQLKE
YPKENSLNEIFFGKAVEEASAKLKIQGQKIKASAPLTAEFQKLQQELETFQSMNDPNGIY
ARLPFNLKIE
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atgaataattttcttaaacaaactgttgccagtttaatcggcagcctactaggtctattt
attttctgtggaattagtactacaggactattactactattgtttgcgatcgccgcttct
caagatgttagtccagtagttaaagataagtctgtggtagtttttgacttatcaatgaat
ataaccgatagagaacctagtgcaggggaagagttacaaagaacattatcaggtaatcca
gaagacaggatcacactccgcaaagttctagaggcgattgaaaaagccaaacaagatccg
aaaattgttggcatatatttagatgggacaaagacaacaggtagtaaccttggtttcgct
tccctcaaagaaattcgcaaagccttagaagaatttcgcgcggcggggaaaaaagtagtg
gcgtatggccaagattggggtaaaaaagaatattacctcagttccgtcgctgataccatt
gcactaaatcctttgggtgcaatagaagtcaatggtttaagtagccaacagatgttctta
acaggagcattgcagaaatttggtattggagtccaggttgtcagagttggtaaatttaaa
ggtgctgtcgaacccttaattctcaacaaactcagtcccgaaaatcgagaacaaacacag
aaattactagacgatgtgtggagtgagtggcggacaacagtaggtacaagccggaaaatc
aacccgcaaaaattgcaagcgatcgctgataatcaagccatagtcgaagcgcccgtagcc
aaaactaatggtttggtagataaagtagcataccatgatcaagtagttgccgatttaaaa
caactcacgggtagtgagcaaaacgataaaacttttcgtcaagttgatctcctagaatac
agccaagtgatcaacaaatcctcaagtgctgccagagaatcaaacaataaaattgccgta
gtttatgccgaaggggaaattgttgatggtagcggtgatgatgaacaagtaggaggcgat
cgctttgctaaaatcttcaacaaaatccggcaagataaaaatatcaaagccgttgtctta
agaattaacagtcccggcggtagtgcgacagccgcagaagttatgcagcgggaagtccgg
ttaacccacgatatcaaacccgtagtagtatcaatgggtgatgtcgctgcctctggaggt
tactggatagccagtgattctagccgcatttttgctgaaccaaatacaatcactggttca
ataggtgtatttggtatcctgttcaacgggcaaaaactagcgaatgataacggcatcact
tgggatgttgtcaaaacagcacgctatgctgataatcaaactgtctctcgtcccaaatcc
ccccaagaactagcactttatcagcgcagtgtgaaccgtatttacagtctatttctcaat
aaagtttcccaagggcgcaaactaccagcacaaaaagtcgccgaaattgcccaaggacgg
atttggtctggtgtagcagctaaacaaattggtttagtagacgaaatcggtggactcaac
gcggctgtacaatatgctgccaagaaagcaaatttaggtaacaattggcaattaaaagaa
tatcccaaagaaaacagcttaaacgaaattttctttggcaaagccgttgaagaggctagt
gcaaagttaaaaattcagggacaaaaaatcaaagcatctgctcctctgacagccgaattt
caaaaactgcaacaagaattagagacatttcaaagcatgaatgaccctaatggaatttat
gcgcgtttgccgtttaatttaaaaattgagtaa

DBGET integrated database retrieval system