KEGG   Nostoc sp. PCC 7107: Nos7107_5439Help
Entry
Nos7107_5439      CDS       T02362                                 

Definition
(GenBank) isopentenyl-diphosphate delta-isomerase
  KO
K01823  isopentenyl-diphosphate Delta-isomerase [EC:5.3.3.2]
Organism
nos  Nostoc sp. PCC 7107
Pathway
nos00900  Terpenoid backbone biosynthesis
nos01100  Metabolic pathways
nos01110  Biosynthesis of secondary metabolites
nos01130  Biosynthesis of antibiotics
Module
nos_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
nos_M00364  C10-C20 isoprenoid biosynthesis, bacteria
Brite
KEGG Orthology (KO) [BR:nos00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Nos7107_5439
Enzymes [BR:nos01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.2  isopentenyl-diphosphate Delta-isomerase
     Nos7107_5439
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FMN_dh IMPDH Glu_synthase NMO
Motif
Other DBs
NCBI-ProteinID: AFY45921
UniProt: K9QL86
Position
complement(6320108..6321157)
Genome map
AA seq 349 aa AA seqDB search
MKAPTSNFAQTQSRKADHIRICLEEDVQCREITSGLENYRFSHCCLPEIDRNDINISTNF
LGKYLAAPLLISSMTGGTEEAGTINRRLAEVAQKYKLAMGVGSQRVAVEKPQVVDTFAIR
KYAPDVLLFANVGAVQLNYKYGLDECLRIIDMLEADALILHINPLQECIQPRGDVNFRGL
LDKISLLCSKLDVPVIAKEVGNGISGAMAEKLMAAGVRAIDVAGAGGTSWAKVEGERAEN
PLQRRLGATFADWGIPTAECITSVRAIAPNIPLIASGGLRHGLDVAKAIALGADIAGLAM
PFLQAAVVSESAIAELVEVLIAEIVTVLFCTGNANLQQLQHSGSLHRIQ
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagcccctaccagcaattttgcacaaactcagtcacgtaaagcagatcatatccgc
atctgtttggaagaagatgttcagtgccgtgaaataaccagtggattagaaaattatcgt
tttagccattgttgtttaccagaaatagaccgcaacgatattaatatcagcacaaatttt
ttaggtaaatacctagcagcaccattattaatttcttcgatgactggaggaaccgaagaa
gccggaactattaatcgccgtttagcggaagttgctcaaaaatataaactagcgatgggt
gtcggttctcaaagggtggcggtagaaaagccccaggtagttgacacttttgctatccgc
aagtatgcaccggatgtattattgtttgccaatgtgggtgctgtgcaactgaactataaa
tatggtctagatgaatgtctgcggatcatcgatatgctagaagctgatgcgttgattctg
cacatcaaccctctgcaagagtgtattcaacctagaggtgatgtgaattttcgtgggctg
cttgacaaaatatcgttattatgcagcaaattagatgtaccggtgattgcgaaggaagta
ggtaatgggatttctggtgcaatggctgaaaaactgatggcggctggagtgagagcaatt
gatgttgcaggtgcggggggaacttcttgggcgaaagtagaaggtgaacgggcagaaaat
cctttgcaacgcaggttaggtgcaacatttgcagattggggtattccaacggcagagtgt
attacaagtgtacgagcgatcgcaccgaatattcctttaatcgcctctggtggcttgcgt
cacggcttagatgtagccaaagcgatcgctttaggtgcagatatcgccgggttagccatg
ccttttttgcaagcagccgtagtctcagaatcagccattgcggagttagttgaagtttta
attgcagaaatagtcacggtgttattttgcactggtaacgctaacttacagcagttacaa
cattctggaagtttacaccgcatacaataa

DBGET integrated database retrieval system