KEGG   Novosphingobium sp. THN1: C7W88_03245Help
Entry
C7W88_03245       CDS       T05635                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
not  Novosphingobium sp. THN1
Brite
KEGG Orthology (KO) [BR:not00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    C7W88_03245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: AXU20468
UniProt: A0A3B7DWZ8
Position
complement(646517..646915)
Genome map
AA seq 132 aa AA seqDB search
MKQLFQHAAITEGVTVRVAVNFLPEQSRVEAGKWFWVYHIRLENDGDQPVQLLSRHWRIT
DGRGMINFVDGDGVVGEQPVLQPGQSHDYVSGCPLGTHHGSMEGHYTMQRADGSLFDVAI
PFFPLAAPAPAN
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgaagcagctcttccagcatgccgccatcaccgaaggcgtcacggtgcgagtcgccgtg
aacttcctccccgaacagtcgcgggtggaagcaggcaaatggttctgggtctatcatatc
cgtctcgagaacgacggcgaccagccggtacaactgctgtcgcgccattggcggatcacc
gacgggcggggcatgatcaacttcgtcgacggtgacggcgtcgtgggcgaacagcccgtc
ctgcagccggggcagagccatgattacgtctcgggctgtccgctcggcacccatcacggc
agcatggaaggccactacacgatgcagcgtgccgatggctcgctgttcgatgtggcgatt
ccattctttcctctggcggcaccggctccggcaaactaa

DBGET integrated database retrieval system