KEGG   Novosphingobium sp. THN1: C7W88_03600Help
Entry
C7W88_03600       CDS       T05635                                 

Definition
(GenBank) beta-glucosidase
  KO
K05350  beta-glucosidase [EC:3.2.1.21]
Organism
not  Novosphingobium sp. THN1
Pathway
not00460  Cyanoamino acid metabolism
not00500  Starch and sucrose metabolism
not01100  Metabolic pathways
not01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:not00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    C7W88_03600
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    C7W88_03600
Enzymes [BR:not01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     C7W88_03600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Glyco_hydro_42 Glyco_hydro_35
Motif
Other DBs
NCBI-ProteinID: AXU18321
UniProt: A0A3B7DQQ8
Position
complement(725941..727266)
Genome map
AA seq 441 aa AA seqDB search
MFDRRAVLAGGVAALAASGASLSAKTTLKAAPSPRFPEGFLWGASTAPHQIEGNNTTSDL
WYLEHQQPTVFAEPSGDAANSFLLWERDLDLAKSIGLNTYRFGVEWARIEPAKGRFSMGM
LGHYRRIIEGCRARGLAPIVTYSHFSAPLWFSAQGGWTNPESTELFARYCTRVTQAMGAG
MHSAITLNEPNILLLLKAMLPKPVWDIQKLTLDTAAKRLGVEKMVCGNVAAYDDLPALQV
GLLAAHKAGRAAIKAVRPDLPVGVSLAMLDDQAVGKNSIRDRMRGELYGAWLEVAKTDDF
IGVQNYERALWGDKGRLPAPEDSVRNWSGTEVWPLSLAGAVRYAHAVTGVPVLVSEHGVG
TDDDAVRAAFIPPSLAGLKQAMDDGVPVIGYCHWSLVDNFEWIFGFRPRFGLASYDPVTF
ERKAKPSAGVLGAIARANALA
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgtttgatcgccgtgccgttctcgccgggggcgttgccgcccttgccgcaagtggtgcc
tcgctgtcggcgaagacgacgctgaaggcggcacccagcccacgctttcccgagggcttc
ctgtggggcgcatcgaccgcgccgcaccagatcgagggcaacaacaccacgtcggacctg
tggtatctcgaacaccagcagcccaccgtctttgccgagccatcgggcgatgcggcgaac
agtttcctgttgtgggagcgtgacctcgatctggccaagtcgatcgggctcaacacctat
cgcttcggcgtggaatgggcgcggatcgagccggccaagggccggttcagcatgggcatg
ctggggcattaccgacggatcatcgaaggctgccgcgcgcgcggccttgcgccgatcgtc
acctacagccacttcagcgcgcccttgtggttcagcgcgcagggcggctggaccaatccc
gagagcaccgagctgttcgcccgctactgcacaagggtgacgcaggcgatgggcgccggg
atgcacagcgcgatcacgctcaacgaacccaacatcctgctgctgctcaaggcgatgctg
ccaaagccggtgtgggacatccagaagctgacgctggacacggcggccaagcggcttggc
gtggagaagatggtctgcggcaacgtggcggcgtacgatgacctgccggcgctgcaggtg
ggactactggccgcccacaaggccggccgcgcggcaatcaaggcagtgcgtcccgacctt
cccgtcggcgtgtcgctggcgatgctggacgatcaggcggtgggcaagaactcgatccgc
gaccgcatgcgcggtgagctttacggggcatggcttgaagtggccaagaccgatgacttc
atcggtgtgcagaactacgaacgcgccttgtggggcgacaagggcaggctgcctgcgcct
gaagacagcgtgcgcaactggtcgggtacggaagtatggcccctctcgctggctggcgcg
gtgcggtatgcccatgcggtaacgggcgtgccggtgctggtttcggagcatggcgtcggc
acagatgacgacgcggtgcgcgccgcgttcattccgccttcgctcgcgggtctcaagcag
gcgatggatgatggcgtgccggtgatcggctattgccactggtcgctggtcgacaacttc
gaatggatcttcggcttccggcccagattcggccttgccagctatgatccggtcaccttc
gagcgcaaggccaagccgagtgccggcgttctgggggcgattgccagggccaacgcgctc
gcgtga

DBGET integrated database retrieval system