KEGG   Novosphingobium sp. THN1: C7W88_04110Help
Entry
C7W88_04110       CDS       T05635                                 

Definition
(GenBank) low specificity L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
not  Novosphingobium sp. THN1
Pathway
not00260  Glycine, serine and threonine metabolism
not01100  Metabolic pathways
not01110  Biosynthesis of secondary metabolites
not01120  Microbial metabolism in diverse environments
not01130  Biosynthesis of antibiotics
not01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:not00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    C7W88_04110
Enzymes [BR:not01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     C7W88_04110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AXU18396
UniProt: A0A3B7DL68
Position
828176..829192
Genome map
AA seq 338 aa AA seqDB search
MKFLSDNTAAVHPKIWDAMRAADAPDSGYDGDALSRHLDEAFSCLFGTECTALWVATGTA
ANCLALAAMVPPHGGVVCHREAHIEMDEGGAPGFYTHGAKLMLADGKGAKLTPQAIERVI
DPIRNDVHQVQPHAISITQATEYGRVYTPEEVARIGSLAQGRGLGLHMDGARFANAVAHL
GCHPAEVTAQAGVDVLTFGCVKNGGMNAEALVFFDMELADVVRYRRKRAGHLQSKGRYLA
AQVLAMIEGDLWLDNARAANAAAQEIAQACGSRVFHAVEANEIFVVLSPAEQATLRAQGF
DFYDWTAPEGAPGAARLVTAWNTDPAHASALARAISAL
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttctctccgacaacaccgccgctgtccacccgaagatctgggacgccatgcgc
gctgccgacgcgcccgattcgggctatgacggcgatgccctgtcgcgccatctggacgag
gcgttctcttgcctgtttggcaccgaatgcacggcgctatgggttgccaccggcacagca
gccaattgcctcgcacttgccgccatggtcccgccccacggcggcgtggtctgccaccgc
gaagcccatatcgaaatggacgaaggcggtgcgcccggcttctacacccacggcgccaag
ctgatgctcgccgatggcaaaggcgcgaagctgaccccgcaggcgatcgagcgcgtgatc
gacccgatccgcaacgacgtccaccaggtccagcctcacgccatctcgatcacccaggcg
acagaatatggccgcgtctatacgccggaagaggtcgcccggatcggctcgcttgcgcaa
gggcgcggccttggcctgcacatggacggcgcgcgttttgccaatgcggtcgcgcacctt
ggctgccatcccgccgaagtgacggcgcaagccggcgtcgacgtcctgaccttcggctgc
gtcaagaacggcggcatgaacgcggaagcgctggtgttcttcgacatggaactcgctgac
gtcgttcgctaccgccgcaagcgcgccgggcatcttcagtcgaagggccggtacctcgca
gcgcaggttcttgcgatgatcgagggcgacctctggctcgacaatgcccgcgccgccaac
gccgccgcgcaggaaatcgcgcaggcttgcggatcgcgcgtgttccacgccgtcgaagcg
aacgagatcttcgtcgtgctctccccggcagagcaggcaacgctgcgcgcgcagggcttc
gacttctacgactggactgcgcctgaaggcgcccccggtgccgcgcggctggtcaccgcg
tggaacaccgacccggctcatgcctctgcgctggcgcgggcaatctctgcgctatga

DBGET integrated database retrieval system