KEGG   Novosphingobium sp. THN1: C7W88_07620Help
Entry
C7W88_07620       CDS       T05635                                 

Definition
(GenBank) PQQ-dependent dehydrogenase, methanol/ethanol family
  KO
K17760  quinohemoprotein ethanol dehydrogenase [EC:1.1.9.1]
Organism
not  Novosphingobium sp. THN1
Brite
KEGG Orthology (KO) [BR:not00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    C7W88_07620
Enzymes [BR:not01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.9  With a copper protein as acceptor
    1.1.9.1  alcohol dehydrogenase (azurin)
     C7W88_07620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PQQ_2 PQQ PQQ_3 Cytochrome_CBB3 Cytochrom_C
Motif
Other DBs
NCBI-ProteinID: AXU20574
UniProt: A0A3B7DP07
Position
1533221..1535401
Genome map
AA seq 726 aa AA seqDB search
MRQLLASLFLGLAACSLGGATALTEGAGREWASPGGDSGKTHHSRLTAINAQNVSQLGLA
WAADLDTFRGQEATPVVVDGVLYTSGTAGRAYAFDAASGKELWRFEPEVDMQVNRTVCCD
MVNRGVAVARGKVFVASLDGWMYALDARTGAVVWKSDFIENRAKGDNSTGAPEVAGDVVV
IGMGGAEYDVRGYVTALDLDTGKLRWRWHVVPHDPKLGPQETPELEAALKTWDPNSRWDI
GGGGSPWDAINYDPETGLVLVGTGNGGPYATSKRSPAGGDNLYLASLVALDPKTGRMKWH
YQETPGDNWDFTATQPMIFTRIDIDGENRPVVLHAPKNGYLYILDRRDGKLLRANPIVRT
NWAKGIDQKTGRPILDPEAADYTTGPKIVFPATTGARNWHPASYDPATGLYIGAVLDMGN
LIFMTPGAKPLKARGLNNDAALIFTPDVKEALAAFPPEFGDAVRKLPAYQEALRQPATAQ
IRAIDPLTGKTVWSADTAGWQDRGGVLTTASGLTIYGGVTGKLFVRETKTGKLLKEIDTG
TPIMAAPMTYEVGGVQYIAVMAGWGGGGYPFVPRYSAAYTRGNMNRLLVFKLGGGTVPMP
DLLPPLEVAPEPPAQSAGVTAATIAKGQGLFFGNCAICHANQPRSITPDLRRMQPGTHEA
FRQIVLQGLLTPNGMPRWDDILSPGDADAIHAYLIDLQGKTRADELAKQKAGKPLDGPSL
TILSNY
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atgcgccagctgcttgccagtctgtttcttggccttgccgcctgctcgctcggcggggcc
acagcgctgaccgagggtgcagggcgggagtgggccagtcccggcggcgattccggcaag
acgcaccattcgcgcctgaccgcgatcaatgcgcagaatgtcagccaactcggcctcgcc
tgggcggctgatctcgacaccttccgggggcaggaagcgacccccgtcgtcgtcgatggc
gtgctctatacgtcgggcactgccggtcgcgcctatgccttcgatgcggcgagcggcaag
gaactgtggcgcttcgagcccgaagtcgacatgcaggtcaaccgcacggtctgctgcgac
atggtcaatcgcggtgtcgccgtggcgcggggcaaggtgttcgtcgcgtcgctcgatggc
tggatgtacgcgctcgatgcgcggaccggcgcggtcgtgtggaagagcgacttcatcgag
aaccgcgccaagggcgacaattccactggcgccccggaagttgcgggcgatgtcgtggtg
atcggcatgggcggcgcggaatacgacgtgcgtggctatgtcactgcgctcgatctcgac
actggcaagctgcgctggcgctggcatgtcgtgccgcacgatccgaagctcgggccgcag
gagacgccggagcttgaagccgcgctcaagacctgggacccgaacagccgctgggacatc
ggcggtggcggtagtccgtgggatgcgatcaactacgacccggaaaccgggctggtcctc
gtcggcaccgggaacggcgggccctatgcgacgtcgaagcgctcgccggcgggcggggac
aacctctacctcgccagcctcgtcgcgctcgatccgaagacggggcggatgaagtggcac
tatcaggaaacgccgggcgacaactgggacttcaccgccacgcagccgatgatcttcacg
cgcatagacatcgatggcgagaaccgtccggtcgtgctgcacgcgcccaagaacggctac
ctctacattctcgaccggcgcgacgggaagctgctgcgcgccaatcccatcgtgcgcacc
aactgggccaagggcatcgatcagaaaaccggacgcccgatccttgatccggaagcggcg
gactataccaccggcccgaagatcgtgttcccggccacgaccggtgcgcgcaactggcat
ccggccagctacgacccggcgaccgggctctacattggcgccgtgctcgacatgggcaac
ctgatcttcatgacgccgggggccaagccgctcaaggcgcgcgggctcaacaacgacgcg
gcgcttatcttcacgcccgatgtgaaggaagcgctggcggcatttccgcccgagttcggt
gatgccgtgcgcaagctgcctgcctatcaggaagcgctgcggcaaccagccactgcgcag
atccgcgcgatcgatccgctgaccggcaagaccgtctggtcggccgacaccgctggctgg
caggatcgtggtggcgtgctgacgactgcatcgggccttaccatctatggcggcgtcacc
ggcaagctgttcgtgcgcgaaacgaagaccggaaagctgctcaaggaaatcgacaccggc
accccgatcatggcggcgccaatgacctacgaggtcggtggcgtgcagtacatcgcggtc
atggccggatggggcgggggcggctatccgttcgtgccgcgctattccgctgcctacacg
cgcggcaacatgaaccggttgctggtgttcaagctgggtggcggcacggtgccgatgccc
gatctgctgccgccactggaagtcgcgcccgagccccctgcacagtccgccggcgtcacc
gcggccaccatcgcaaaggggcaggggctgttctttggcaactgcgccatttgccacgcc
aaccagccgcgctcgatcacgcccgatctgcgccggatgcagccgggcacgcacgaggcg
ttccgccagatcgtgctgcaagggctgctgacgccgaacgggatgccgcgctgggacgat
atcctctcgcccggcgatgccgatgcgatccacgcctatctgattgacctgcagggcaag
acccgtgccgacgagcttgccaagcagaaggccggcaagccgcttgacgggccgagcctg
acgatcctctcgaactattga

DBGET integrated database retrieval system