KEGG   Novosphingobium sp. THN1: C7W88_09005Help
Entry
C7W88_09005       CDS       T05635                                 

Definition
(GenBank) NADP-dependent isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
not  Novosphingobium sp. THN1
Pathway
not00020  Citrate cycle (TCA cycle)
not00480  Glutathione metabolism
not01100  Metabolic pathways
not01110  Biosynthesis of secondary metabolites
not01120  Microbial metabolism in diverse environments
not01130  Biosynthesis of antibiotics
not01200  Carbon metabolism
not01210  2-Oxocarboxylic acid metabolism
not01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:not00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    C7W88_09005
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    C7W88_09005
Enzymes [BR:not01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     C7W88_09005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AXU19135
UniProt: A0A3B7DN20
Position
complement(1806104..1807327)
Genome map
AA seq 407 aa AA seqDB search
MAKIKVKNPVVELDGDEMTRIIWEWIRERLILPYLDIDLKYYDLSVQKRDETDDQITIDS
ANAIKQYGVGVKCATITPDEQRVEEFNLKSMWKSPNGTIRNILGGVVFREPIVIQNVPRL
VPGWTDPIVVGRHAFGDQYRATDFVVPGPGKLRLVWEGDNGETIDREVFNYPSGGVAMAM
YNLDDSIRDFARASFNYGLSLGWPVYLSTKNTIMKAYDGRFKDLFQEVFDSEGFKEKFAA
AGISYEHRLIDDMVASALKWSGKFVWACKNYDGDVQSDTVAQGFGSLGLMTSVLMSPDGK
TIEAEAAHGTVTRHYRQHQQGKQTSTNPIASIFAWTRGLMYRGKFDETPEVVKFAETLER
VCIETVESGKMTKDLALLIGPDQAWMTTEKFFEAIVENLETEMKNWA
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagatcaaggtgaagaacccggtcgtcgaactcgacggcgatgaaatgacccgg
atcatctgggaatggatccgtgaacgcctgatccttccctacctcgacatcgacctcaag
tactacgacctctcggtccagaagcgcgacgagacggacgaccagatcaccatcgattct
gccaacgcgatcaagcagtacggcgtcggcgtgaagtgcgccacgatcacccctgacgag
cagcgcgtcgaggaattcaacctcaagtcgatgtggaagtcgcccaacggcacgatccgc
aacattctcggcggcgtggtgttccgcgagccgatcgtgattcagaacgtgccgcgcctg
gtcccgggctggaccgatccgatcgtcgtcggccgtcacgcttttggtgaccagtatcgc
gccacggacttcgtcgtccccggccccggcaagctgcgcctcgtctgggaaggcgacaac
ggcgagacgatcgaccgcgaagtgttcaactacccctcgggcggcgtcgccatggcgatg
tacaacctcgacgattcgatccgcgacttcgcgcgcgcctctttcaactacggcctgtcg
cttggctggccggtctacctgtctaccaagaacacgatcatgaaggcctatgacggccgc
ttcaaggacctgttccaggaagtgttcgacagcgaaggcttcaaggaaaagtttgccgcc
gccggcatcagctacgaacaccgcctgatcgacgacatggtcgcctcggcgctcaagtgg
tccggcaagttcgtctgggcctgcaagaactacgacggtgacgtgcagtccgacacggtt
gcacagggcttcggttcgctcggcctgatgacctcggtcctcatgtcgcccgatggcaag
accatcgaggccgaagctgcccacggcaccgtgacccgtcactaccgccagcaccagcag
ggcaagcagacctcgaccaacccgatcgcctcgatcttcgcctggacccgtggcctcatg
taccgcggcaagttcgacgagaccccggaagtcgtgaagttcgccgaaacgctcgagcgc
gtctgcatcgaaaccgtcgaaagcggcaagatgaccaaggacctcgccctgctgatcggc
cccgatcaggcgtggatgaccaccgagaagttcttcgaagccatcgtcgagaacctcgaa
accgaaatgaagaactgggcgtaa

DBGET integrated database retrieval system