KEGG   Novosphingobium sp. THN1: C7W88_09340Help
Entry
C7W88_09340       CDS       T05635                                 

Definition
(GenBank) adenosylmethionine--8-amino-7-oxononanoate transaminase
  KO
K00833  adenosylmethionine---8-amino-7-oxononanoate aminotransferase [EC:2.6.1.62]
Organism
not  Novosphingobium sp. THN1
Pathway
not00780  Biotin metabolism
not01100  Metabolic pathways
Module
not_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:not00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    C7W88_09340
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:not01007]
    C7W88_09340
Enzymes [BR:not01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.62  adenosylmethionine---8-amino-7-oxononanoate transaminase
     C7W88_09340
Amino acid related enzymes [BR:not01007]
 Aminotransferase (transaminase)
  Class III
   C7W88_09340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AXU19190
UniProt: A0A3B7DJT1
Position
1865612..1866892
Genome map
AA seq 426 aa AA seqDB search
MTAPDWFDTGRKHVWLPYTQMQTARAPLPVASAAGTRLRLSDGRELIDGISSWWACVHGY
RHPHIEEAVRRQLETLPHVMLGGLAHEQAYTLARRLAALLPGDLDHVFFSDSGSVAVEVA
MKMASQYWLNRGRRRVKFLCFKGGYHGDTFATMSVCDPDEGMHSLFKGALLDQIVVNLPT
NPAEEAALGELLDRHGHDLAGIVVEPLVQGAGGMVFHDPFTLHVLRRLADAHELLLIFDE
IFVGLGRLGDAMFACEIAGVQPDIVTLSKALTGGTLPLAATIASRRIHEGFLSDDPMHAL
MHGPTYMGNALGCAAANASLDLFEQEPRLAQASAIGRQLQTLLEPARALPGVRDVRVRGA
IGVIQLDGPAPADRLSASCISSGVWLRPFRDILYTTPPLIASEEDVAHIANAMVSAVSEW
SADRAT
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccccagactggttcgacacgggtcggaagcatgtgtggctcccgtacacccag
atgcaaactgccagagcgccgcttccggtggcttcggcggccggtactcgacttcgtctg
tccgacggaagggaactgatagacggcatttccagctggtgggcctgcgtccatggctac
cgccatccccacatcgaagaagcggtgcgccgccagctagaaacgctgccccatgtcatg
ctcggcggtctggcccacgagcaggcctataccctcgcgcggcggctcgctgcattgctg
cccggcgatctggaccacgttttcttcagcgattccggctcggtcgcagtcgaagtcgca
atgaagatggcttcgcaatattggctcaatcgcggacggcgccgagtgaagttcctctgc
ttcaaaggcggctatcacggggacacttttgcaacgatgagcgtttgcgatccggatgaa
ggcatgcacagcctgttcaagggggcattgctcgatcagatcgtggtcaacctcccaaca
aatcctgcggaagaggctgcgcttggcgaactgctcgatcgtcatggtcatgatcttgcc
ggcattgttgtcgagcccttggtgcagggcgcgggcggcatggtgtttcacgatccgttt
acattgcacgtgctgcgtcgccttgccgatgcgcacgaactcctgctgatcttcgatgag
atcttcgtggggctcgggcgacttggcgatgcgatgttcgcctgtgagatcgccggcgtc
cagcctgacattgtcacattgtcgaaggccttgaccggcgggaccctgccgcttgccgcc
acgatcgcaagtcggcgcattcacgaaggtttcctgtccgacgatccgatgcatgcgctg
atgcatgggccgacctacatgggcaatgccctgggttgcgctgccgccaatgcttcgctt
gatcttttcgaacaggagccgcgtctggctcaagccagcgcgatcggtcggcaactccag
acgttgctcgaacctgcccgcgctttgcctggggtaagggacgtgcgtgtgcgcggtgcc
atcggcgtgatccagctggatggtcctgcgcccgccgatcgcctgtccgccagctgcatt
tcaagtggtgtctggcttcgtccgttccgcgatatcctgtacaccacgcccccgctcatc
gccagcgaggaggatgttgcgcacatcgccaacgccatggtttcggctgtcagcgaatgg
agcgccgaccgggcaacttga

DBGET integrated database retrieval system