KEGG   Novosphingobium sp. THN1: C7W88_09785Help
Entry
C7W88_09785       CDS       T05635                                 

Gene name
murD
Definition
(GenBank) UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
not  Novosphingobium sp. THN1
Pathway
not00471  D-Glutamine and D-glutamate metabolism
not00550  Peptidoglycan biosynthesis
not01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:not00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    C7W88_09785 (murD)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    C7W88_09785 (murD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:not01011]
    C7W88_09785 (murD)
Enzymes [BR:not01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     C7W88_09785 (murD)
Peptidoglycan biosynthesis and degradation proteins [BR:not01011]
 Precursor biosynthesis
  Amino acid ligase
   C7W88_09785 (murD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C NAD_binding_7 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AXU19258
UniProt: A0A3B7DU01
Position
1966962..1968293
Genome map
AA seq 443 aa AA seqDB search
MIVSPAFSGKRFAVLGLARSGQASVEALLAGGADVTVWDSREEPRAAYEGRCTIADPLAT
DLTGFAGVVVSPGVPLNRHPIAAHAASFGVPVIGDIELFAQARADLPPHRVVGITGTNGK
STTTMLVHHICKAAGLEARLGGNIGLPVLGQEPLPEGGVYVLELSSYQIDLTQSLDCDVA
ALINLSPDHLDRYDGFEGYAAAKARLFRMQSARHHAVFGCGDEHTLKIARETSATHDVGF
VHVVQPDALEGQTAWPSLQGPHNLQNAAIAVEIARQLGIGEDVWGPALTSFVGLPHRMER
VAEANGVLFVNDSKATNPASTAPALGAYPRIHWILGGLPKSDNLDECAPYFDHVVAAYTI
GEAGPMFADILDPIMPVNRSEMMCDAVRQAMQAAQPGDVVMLSPACASFDQFRDFEARGD
SFRQIVEALIADSDAPCPPGTGS
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgatcgtctcgcccgccttttccggcaaacgcttcgccgtgctcggccttgcccgttcg
gggcaggcgagcgtcgaggcgctgctggcgggcggggcggacgtcaccgtgtgggacagc
cgcgaggaaccgcgcgcagcctacgaagggcgctgcactatcgccgatccactggcgacc
gacctgaccgggtttgcgggcgtggtggtgagccccggggtgccactcaatcgccatccg
attgccgcccacgccgcttctttcggtgtaccggtgatcggcgacatcgaacttttcgcg
caggcccgcgccgacttgccgccgcatcgcgtggtcggcatcaccgggaccaacggcaag
tcgacgacgacgatgctggtccaccacatctgcaaggcggcgggtctcgaggcgcggctg
ggcggaaatattggcctgccagttctggggcaggagccgctgcccgaaggcggcgtctat
gtgctcgagctgtccagctaccagatcgacctgacgcagagccttgattgcgatgtcgct
gcgctgatcaacctcagccccgatcaccttgaccgctacgatggctttgaaggttacgcc
gcggccaaggctcgcctgttccggatgcagtcggcgcgccatcacgccgtgttcggttgc
ggtgacgagcataccctgaagatcgcgcgcgaaacttcggccacgcatgacgtcggcttc
gtccatgtggtgcagcctgatgcgctggaggggcaaacggcttggccctcgctgcaaggg
ccgcacaacctgcagaatgctgcgattgcggtggagatcgcgcggcagcttggcatcggc
gaagacgtgtggggtccggcgctgaccagtttcgtcggccttccgcaccgcatggaacgc
gtggccgaggccaatggcgtgctgttcgtcaacgacagcaaggctaccaatccggcctcg
accgcgcctgcgctcggcgcctatccgcgtatccactggatcctcggtggcctgcccaag
agcgacaacctcgatgagtgcgcgccctacttcgaccacgttgtcgccgcctacacgatc
ggcgaggcagggccgatgtttgccgacatcctcgatcccatcatgccggtcaaccgcagc
gagatgatgtgcgatgccgtgcgtcaggcgatgcaggcagcgcagcccggcgacgtggtg
atgctttcgccagcgtgcgccagcttcgatcagttccgcgatttcgaggcgcgcggcgac
agctttcgccaaattgtcgaggcgctgattgccgattccgatgcaccctgtccgccgggg
actggttcatga

DBGET integrated database retrieval system