KEGG   Novosphingobium sp. THN1: C7W88_12170Help
Entry
C7W88_12170       CDS       T05635                                 

Definition
(GenBank) biotin carboxyl carrier protein
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
not  Novosphingobium sp. THN1
Pathway
not00620  Pyruvate metabolism
not01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:not00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    C7W88_12170
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:not02000]
    C7W88_12170
Enzymes [BR:not01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     C7W88_12170
Transporters [BR:not02000]
 Other transporters
  Primary active transporters [TC:3]
   C7W88_12170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like FapA
Motif
Other DBs
NCBI-ProteinID: AXU19611
UniProt: A0A3B7DUH6
Position
complement(2462968..2464440)
Genome map
AA seq 490 aa AA seqDB search
MTEIRLVDVTMRDGNQSLWGATGLNTAHMLQAAALTEACGFRAIDFTSSSHMAVAVRYFQ
NNPWERLRRMSAAMPTTPLQFITTGLRFIAWQQADPEFMRLVYRALQANGVGRFVLLDPM
HEVPAVIEAAKLVKEEGNAEVMAALTFTLSEIHTDQFYADFARAVGQSPNIDLFYIKDPA
GLLSMDRARTLVPAVKAAIGNRPLEIHAHTTVGQGMLASLEATKLGISAIHVGVGPGGDG
SSLPEANRMVANLEEAGFSVGIDKAALKRLTSYWQSVALAEGLPPGTPQNFDASFLRHQI
AGGVMTTIARQLEELGLSDRMNAVIEETGQVRADLGFPIMVTPFPQMVMTQALFNVIGER
RYAQVSDQVIRYCMGKFGKPTSPVDREVLATIMDRPRARELEKEPTFPALGDLRRQFGYH
MPDEEFLLRAVMPAEQVDAMLAAGRSRATYSPKAAPIISLLRKLAAKPDARDIVIERGSF
RLALHAGAAL
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagatccgtctcgtcgacgtcaccatgcgcgacggcaaccagagcctgtggggc
gcgaccggcctcaataccgcgcacatgctgcaagctgccgcgctgaccgaagcctgcggg
ttcagggccattgatttcacgtcgtcgagccacatggccgtggccgtgcgttacttccag
aacaatccctgggaacgcctccgccgcatgtcggcggccatgccgacaacgccgcttcag
ttcatcaccaccggcttgcgcttcatcgcctggcagcaggccgatcccgagttcatgcgt
ctggtctaccgcgccttgcaggccaacggcgtggggcgttttgtcctgctcgacccgatg
cacgaggtgcccgcggtgatcgaggcggcgaagctggtgaaggaagagggcaacgccgaa
gtgatggcggcgctgaccttcacgctttccgagatccacaccgaccagttctatgccgat
ttcgcgcgtgccgtcgggcagagcccgaacatcgacctattctatatcaaggacccggcg
ggcctgctctcgatggatcgcgctcgcacgctggtcccggcggtgaaggccgcgatcggc
aaccgcccgctcgagatccatgcccataccactgttggccaaggcatgttggcgagcctt
gaggcgacaaaactcggcatttccgcgatccatgttggcgtcggcccaggtggcgacggc
tcttctctgccggaagccaatcgcatggttgccaatctcgaagaggccggtttctcggtt
ggcatcgacaaggctgcgctcaagcgcctgacgtcctactggcagagcgtcgcgctggct
gaggggcttccgccgggcacgccgcagaacttcgacgccagcttcctgcgtcaccagatc
gccggtggcgtgatgaccacgatcgcgcgccagctcgaagagcttggcctgtcggaccgg
atgaacgcggtgatcgaagagaccgggcaagtccgcgccgacctcggctttccgatcatg
gtcacgcctttcccgcagatggtcatgacccaggccctgttcaacgtgatcggcgagcgg
cgctatgcgcaggtatcggatcaggtcatccgctattgcatgggcaagttcggcaagccc
acttcaccggtcgaccgggaagtgctcgccaccatcatggatcgccctcgtgcgcgtgaa
ctggagaaggaaccaaccttccctgcactcggcgatctgcgccgccagtttggctaccac
atgcccgacgaggagttcctccttcgtgcagtcatgcccgccgaacaggttgacgccatg
ctcgcggcaggtcgctcccgcgcgacctattctcccaaagccgcgccaatcatttcactg
ctgcgcaagctggcggcgaagccagacgcacgtgacatcgtgatcgaacgcggatctttc
cgccttgccctccatgccggagcagcgctttga

DBGET integrated database retrieval system