KEGG   Natronococcus occultus: Natoc_0035Help
Entry
Natoc_0035        CDS       T02426                                 

Definition
(GenBank) phosphate/sulfate permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
nou  Natronococcus occultus
Brite
KEGG Orthology (KO) [BR:nou00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    Natoc_0035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AGB35917
UniProt: L0JSE9
Position
complement(38444..39631)
Genome map
AA seq 395 aa AA seqDB search
MVELVTVATFLIAAVASLFMAWAIGAGSSGSTPFAPAVGANAISVMRAGFFVGILGFAGA
VLQGANVSEAVGTELIGGVTLSPAAATIALIIAAGLVAIGVFAGYPIATAFTVTGAVVGA
GLAMGGDPAWPKYAEIVTLWVLTPFVGGGIAYAIARTLRAEPIAEEYLIVALAALVGVIV
ANIEFAVLGPPDGGASIAQSAGGWLPGPELVGAAAVTTLMAAVWALAIGFDLRIGLERGE
RHFLLILGALVAFSAGGSQVGLAIGPLIPLSGDVGLPLLALLVGGGFGLLLGSWTGAPRM
IKAISQDYSSLGPRRSIAALIPSFVIAQVAVLFGIPVSFNEIIVSSIIGSGYAAGSGGGV
SARKMGYTVLAWVLSLAGSIVIAFGGYLAVEAVLL
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggtcgaactggtgacggttgcgacgtttctgatcgccgcagtcgccagtctgtttatg
gcctgggcgatcggcgccggatcgagtggatcgaccccgttcgcccccgcagtcggagcc
aacgcgatctcggtgatgcgggccggcttcttcgtcgggattctcgggttcgcaggggcg
gtgttgcagggagcgaacgtctccgaggcggtcggaacggagctgatcggcggcgtgacg
ctgtcgccggcggccgcgacgattgccctgatcatcgccgcgggactggttgcgatcggc
gtcttcgcggggtatccgatcgcgaccgcgttcaccgtcacgggtgccgtcgtcggcgcc
gggctcgcgatgggcggcgaccccgcctggccgaagtacgccgaaatcgtcacgctctgg
gtcctgacgccgttcgtcggcggggggatcgcctacgcgatcgcgcgaacgctgcgggcc
gaaccgatcgccgaggagtacctcatcgtcgcactggcggccctggtcggagttatcgtc
gccaacatcgagttcgccgtccttggaccgcccgacggcggggcctcgatcgcccagagc
gcggggggctggcttccggggcccgaactcgtcggcgccgccgcggtgacgacgcttatg
gccgccgtctgggcgcttgccatcggcttcgatctccggattggcctcgaacgtggcgag
cgacacttcctgctcatcctcggcgcgctcgtcgcgttctccgccggcggtagccaggtc
gggctcgcgatcggcccgctgatcccgctgtcgggcgacgtcggactgccgttgctcgcc
ctgctcgtcggcggcggattcgggctgttgctcggctcctggaccggcgcgccacggatg
atcaaggcgatctcgcaggactactcctcgctcggcccccggcgctcgatcgccgcgctg
atcccgtcgtttgtcatcgcgcaggtggcagtgctgttcggcatccccgtctcgttcaac
gagatcatcgtcagctcgatcatcggtagcggctacgccgccggctccggtggcggcgtc
agcgcgcgcaagatggggtacaccgtcctcgcctgggtcctctcgcttgcgggatcgatc
gtcatcgcgttcgggggctatctcgccgtcgaggccgttctgctctga

DBGET integrated database retrieval system