KEGG   Natronococcus occultus: Natoc_0059Help
Entry
Natoc_0059        CDS       T02426                                 

Definition
(GenBank) phosphate/sulfate permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
nou  Natronococcus occultus
Brite
KEGG Orthology (KO) [BR:nou00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    Natoc_0059
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 Cation_efflux
Motif
Other DBs
NCBI-ProteinID: AGB35941
UniProt: L0JT80
Position
61824..63005
Genome map
AA seq 393 aa AA seqDB search
MSELLLVVGLLVAAFVGYNIGGATTGPAFGPAVGANVITKLMAAALMAVFFFLGAITIGP
NVVDTLGEELVTDTAIFTMRSNVAVLFFIGGALFVGNYAGVPASTSMTAVGAIAALGLAT
GELDFAVLGEIVVWWIVAPIIGFWVAGVVGRYFYPRINERIAIEGNREGREMITLDRSRT
VPRLQFGEGANRREITGAFVVVGIGCLMGFSSGTSNIANAIAPIYGTGDVDMIPLILIGS
AAVAVGCFTIARRTLDTLGNDITNLPLTAAIVVAVISSTIVVGLSWIGIPASFVVIATMS
IIGLGWGRASRTTTISDAREGEETHVSVGALAAEEEGEQSPEIGEENPEDIPKASDLFDP
STTARVILMQNVVPIISTVGAYLTFRFIPVFGL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgaattactgctcgttgtcgggctcctcgtcgcagccttcgtcggttacaacatc
ggcggcgcgacgacgggacccgcgttcggaccggccgtcggcgcgaacgtgatcacgaag
ctcatggcggctgcgctgatggcggtctttttcttcctcggcgcgatcaccatcggtccg
aacgtcgtcgacacgctcggcgaggaactggtcaccgatacggcgatcttcacgatgcgg
tcgaacgtcgccgtcctctttttcatcggcggcgcgctgttcgtcggcaactacgccggc
gtgcccgcctcgacgtcgatgaccgccgtcggggcaatcgctgcgctcggtctcgcgacc
ggcgagctcgacttcgccgtcctcggggagatcgtcgtctggtggatcgtcgctccgatc
atcggattctgggtcgcgggcgttgtcggccggtacttctatccgcgaatcaacgagcgg
atcgccatcgaaggcaaccgcgaaggtcgcgagatgatcacgctcgatcgttcgagaacg
gtcccccgtctacagttcggtgagggggccaaccgccgcgagatcaccggcgcgttcgtc
gtcgtcgggatcggctgtctgatgggcttttcctctgggacgagcaacatcgcgaacgca
atcgccccgatctacggtaccggtgacgtcgacatgatcccgctgatcctgatcgggtcg
gctgccgtcgcggtcggctgttttaccatcgcccgacgaacgctcgacacgctcggcaac
gacatcaccaacctgccgctgacggccgcgatcgtggtcgcggtcatcagctcaacgatc
gtcgtcggcctctcctggatcggtatccccgctagcttcgtcgtcatcgcgacgatgagt
attatcgggctcggatggggccgagcctcacggacgacgacgatttcggacgcacgagag
ggcgaagagacccacgtctcggttggtgcactcgccgcagaagaggaaggcgaacagtca
ccagagatcggcgaggaaaaccctgaggatatcccgaaagcgtcggatctgttcgacccc
tcgacgacagcgcgagtgatcctcatgcaaaacgtcgtcccgatcatctcgacggtcggt
gcctacctcacgtttcggtttattcccgtgttcgggctgtga

DBGET integrated database retrieval system