KEGG   Natronococcus occultus: Natoc_1779Help
Entry
Natoc_1779        CDS       T02426                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
nou  Natronococcus occultus
Brite
Enzymes [BR:nou01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Natoc_1779
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_N Sod_Fe_C
Motif
Other DBs
NCBI-ProteinID: AGB37577
UniProt: L0JX01
Position
complement(1724331..1724933)
Genome map
AA seq 200 aa AA seqDB search
MTDHELPELPYDYDALEPAISEQVVTWHHDTHHQGYVDGLNSAEKTLEENRESGDFSSSG
AAMENVTHNGSGHYLHTLFWENMSPDGGGEPEGDLADRIEEDFGSYEAWKGEFEAAASGA
GGWALLVYDPVAKQLRNLKVDRHDLHALWGAHPILACDVWEHSYYYDYGPDRGEFIDGFF
DVVNWDKAAEEYEKCLDHFE
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgactgatcacgaacttccggaacttccgtacgactacgacgcactcgagccggcgatc
tccgaacaggtcgtcacctggcatcacgacacgcaccaccaggggtacgtcgacggcctg
aacagcgccgagaagaccctcgaggagaaccgcgagagcggcgacttcagctcgtccggc
gctgcgatggaaaacgtcacccacaacggcagtggccactatctccacacgctgttctgg
gagaacatgtcccccgacggcggcggcgaacccgagggcgacctcgccgaccgcatcgag
gaggacttcggctcctacgaggcctggaagggcgaattcgaggccgccgcgagcggcgcc
ggtggctgggcactgctcgtctacgatcccgtcgccaagcagctgcgcaacctgaaggtc
gaccgtcacgaccttcacgcgctgtggggtgcccaccccatcctcgcctgtgacgtctgg
gagcactcgtactactacgactacggcccggaccgcggcgagttcatcgacggcttcttc
gacgtcgtcaactgggacaaggccgcagaagagtacgagaagtgcctcgaccacttcgag
taa

DBGET integrated database retrieval system