KEGG   Natronococcus occultus: Natoc_3381Help
Entry
Natoc_3381        CDS       T02426                                 

Definition
(GenBank) nucleoside-diphosphate-sugar epimerase
  KO
K00091  dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
nou  Natronococcus occultus
Brite
Enzymes [BR:nou01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydroflavonol 4-reductase
     Natoc_3381
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD NAD_binding_10 NAD_binding_4 RmlD_sub_bind Polysacc_synt_2 NmrA adh_short
Motif
Other DBs
NCBI-ProteinID: AGB39113
UniProt: L0K4S1
Position
complement(3305899..3306867)
Genome map
AA seq 322 aa AA seqDB search
MTGDTAAVTGATGFLGTHLCDHLRSEGWEVRGLSRSGPGRDDPEDVEWYVGDLFDRGVLE
SLVDDTDVVFHLAGASLWNADPETVHRVNRDGTATLLEACAATDAGRVVFTSTSGTRRPN
GSDPVADETNVAEPIGAYQASKARAESLVDRYAERTGDAVTTHPTSIFGPGDRNFTAQLL
AMGIERTMPAYLPGGLSIVGVDDVVAGLVAAAERGERGEHYILGGENLTYDRAVSRIGDA
LDGAPARVPVPPTAIHAAGPVAELVDATTGRRVFPFDRRMARLATQRLFYTSRKAHEELG
YTYRPLEAHLPETAAWYRTEFG
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaccggggacaccgccgcagtcaccggcgcaacggggtttctgggaacccacctctgt
gaccatctccggtccgaggggtgggaggtccgcgggctcagccgctcgggccccggtcgg
gacgaccccgaggacgtcgagtggtacgtcggcgacctcttcgatcggggcgtcctcgag
tcgctggtcgacgacaccgacgtcgtcttccacctcgcgggcgcgagcctctggaacgcc
gacccggagaccgtccaccgggtcaaccgggacgggaccgcgaccctgctcgaggcctgt
gcggcgaccgacgccgggcgcgtggtgtttacgagcacctcggggacgcgccgtccgaac
gggagcgaccccgtcgccgacgagaccaacgtcgccgaaccgatcggcgcctatcaggcc
tcgaaagcccgagccgagagcctcgtcgaccgctacgccgagcgaaccggcgacgcggtg
acgacgcacccgacatcgatcttcggccccggtgatcggaacttcaccgcccagctgctc
gcgatggggatcgaacggacgatgccggcctacctccccggaggactcagtatcgtcggc
gtcgacgacgtcgtcgcagggctggtcgccgcggccgaacgcggcgagcgcggcgaacac
tacatcctcggcggcgagaacctcacctacgaccgggccgtctcgcggatcggcgacgcc
ctcgacggcgctcccgcgcgggtgcccgtcccgccgactgcgattcacgcggcgggtccc
gtcgccgaactcgtcgacgccaccaccggtcggcgcgtgttccccttcgaccgccggatg
gctcggctcgcgacccagcggctgttctacacctcccggaaggcccacgaggaactgggc
tacacctaccgcccgctcgaggcccaccttccggagacggccgcctggtaccggacggag
ttcggatag

DBGET integrated database retrieval system