KEGG   Novosphingobium sp. P6W: TQ38_000030Help
Entry
TQ38_000030       CDS       T05550                                 

Gene name
hemN
Definition
(GenBank) oxygen-independent coproporphyrinogen III oxidase
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
nov  Novosphingobium sp. P6W
Pathway
nov00860  Porphyrin and chlorophyll metabolism
nov01100  Metabolic pathways
nov01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nov00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    TQ38_000030 (hemN)
Enzymes [BR:nov01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     TQ38_000030 (hemN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM
Motif
Other DBs
NCBI-ProteinID: AXB77925
UniProt: A0A2Z5EE30
Position
1:complement(5787..7103)
Genome map
AA seq 438 aa AA seqDB search
MTWTYHPELLAIPVPRYTSYPTAAEFDDSVGTPQLEAALGGVNGEVSLYVHIPFCEKICW
YCGCNTSVANRRDRVASYLDALHREIVLMAGRLPDGARVTRIAFGGGSPNGISPVDFVRL
VDALTLQFAASGPVISIELDPRTLGPEWADVIGTVGIERASLGVQTFAPGLQAAIGRIQP
TPMIEEATATLRRAGVQSLNFDLMYGLPGQTMAHLRDSLERTAGLGADRIALFGYAHVPH
LIPRQRKIDASDLPGAAARFAMAAFGYEFLLEEGYVPVGFDHFARPGDALAQATLSGNLK
RNFQGFTDDQAPVLLGLGASAIGSFPDVMVQNEKNTGRYRMMLSQERLAASRGIVRSAGD
RRRGAVIEGLMCRGRARIEPDLRAEAWPLLAPYFDARLCETDGDDLVILPGGLPYARSIA
ARFDPYRKDSLRRFSSAV
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgacctggacctatcaccccgaactgctggcgattcccgtcccgcgctataccagctac
ccgacggcagcggagttcgacgactccgtagggacgcctcagcttgaggccgcgctgggc
ggcgtgaacggcgaagtctcgctctatgtccacatcccgttctgcgagaagatctgctgg
tactgcggctgcaacaccagcgttgccaatcgcagggaccgggttgccagctacctcgat
gcgctccaccgcgagatcgtcctcatggcagggcgcctgccggacggcgcacgggtcacg
cgcatcgcctttggcgggggcagtcccaacggtatttcgccggtcgatttcgtgcggctg
gtagatgccctgaccttgcagttcgcggcatccggcccggtgatttccatcgaactggat
ccgcgcacactcggcccggaatgggcggatgtgatcggcaccgtcggcatcgagcgggcc
agccttggtgtccagacctttgcgccgggcttgcaggcggcgataggccgcatccagccc
acgcccatgatcgaggaggcgacggccacgctgcgcagggcgggcgtgcagtcgcttaac
ttcgatctgatgtacggtttgccggggcagacgatggcgcatttgagggactcgctggaa
cgcaccgccgggcttggcgctgaccgcatcgccttgttcggctatgcccatgtgccccac
ctcatcccccgccagcgcaagatcgatgccagcgatttgccgggtgcggctgcgcggttc
gccatggctgctttcgggtacgaatttctgctggaggagggctatgtcccggtcggcttc
gaccatttcgcccggcccggcgacgcactggcgcaggcgaccctgtccgggaatcttaaa
cgcaatttccagggatttaccgacgatcaggcgccggtgctgctgggccttggtgcctcg
gcgattggcagttttccagacgtgatggtccagaacgagaagaacaccgggcgctatcgc
atgatgctctcgcaggagcgcctcgctgccagtcgcggcatcgtgcgcagcgccggggat
cgcaggcgcggcgctgtgatagaggggctgatgtgccggggccgggctaggatcgagccg
gatctgcgcgccgaggcatggccgctgctcgcgccctatttcgatgcgcgcctgtgcgag
acggacggcgacgatctggttatcctgccgggagggctgccctatgcccgctcgatcgcg
gcgcgtttcgatccctatcgcaaggactcgctgcggcgtttcagttcggccgtctga

DBGET integrated database retrieval system