KEGG   Novosphingobium sp. P6W: TQ38_003020Help
Entry
TQ38_003020       CDS       T05550                                 

Definition
(GenBank) bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
nov  Novosphingobium sp. P6W
Pathway
nov00770  Pantothenate and CoA biosynthesis
nov01100  Metabolic pathways
Module
nov_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:nov00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    TQ38_003020
Enzymes [BR:nov01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     TQ38_003020
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     TQ38_003020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein
Motif
Other DBs
NCBI-ProteinID: AXB75611
UniProt: A0A2Z5E7N6
Position
1:610250..611695
Genome map
AA seq 481 aa AA seqDB search
MNGPRILLVVGGGIAAYKSCELVRTIRKEGGSVTCVLTEGGAKFVTPMTLAALSEKPVHT
TLWDLRNEAEMGHIQLSREADLVVVCPATADLMAKMAAGIADDLATTLLLATDKPVMAIP
AMNVRMWQHAATTRNVQTLRASGVDVMEPDEGPMACGEFGPGRLPEVQMIWQRIARALAG
GSVMDAPQADAADGQGVGGITGSTVARGGKAIGLGDSSSLVATKGEARAAPPTDPDAINH
LITGGAAPQPFDPLTGQPDFDRGLEHRPLYGRHVLVTAGPTHEPIDPVRYIANRSSGKQG
FAIAAAAAEAGARVTLVAGPVHLPTPPGVERIDVESALEMADAVEAALPADVAVMVAAVA
DWRVSRSADQKLKKKNGDGPPTLELTENPDILATLAKSAGRPSLVVGFAAETQDVIRYAR
EKRVRKGADWIIANDVSGDVMGGDANTVHIVTESDVISLPEMPKEDVARILVERFADALP
R
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgaacggaccccgtattctgctggtcgtgggtggcggcatcgctgcctacaagtcctgc
gaacttgtgcgcaccatccgcaaggagggtggctcggtcacatgcgtgctgaccgagggc
ggcgcgaaattcgtgacgcccatgacgctggccgcgctttcggaaaagccggtccacacc
accttgtgggacctcaggaacgaggccgaaatgggccatatccagctcagccgcgaggcc
gatctggtggtggtctgcccggcgacggcggatcttatggccaagatggcggcaggcatt
gccgacgatctggcgaccacgctgctgctggccactgacaagccggtcatggcgatcccg
gcgatgaacgtgcgcatgtggcagcatgcggcgaccacccgcaacgtccagaccctgcgc
gcctccggcgtcgatgtcatggagccggatgaaggcccgatggcctgcggcgagttcggc
cccggccgcctgcccgaagttcagatgatctggcagcggatcgcccgggcgctggccggt
gggtcggtcatggacgcgccccaggccgatgcggctgacgggcagggcgttggtggcatc
accggctcgacggtcgcgcgcggcgggaaagccatcggtctcggcgattcctcttcgctg
gtggcgaccaagggcgaagcgcgcgccgcaccgccgaccgaccccgatgcgatcaatcac
ctcatcacgggcggcgctgcgccgcagccgttcgatccgcttaccggccagcccgatttc
gatcgcgggctcgaacatcggccgctgtatggacgccatgtgctggttactgccggcccg
acccacgagccgatcgaccctgtacgctacatcgccaaccgctcctccggcaaacagggc
tttgcgatcgccgccgccgctgcagaagccggcgcacgggtgacgctggtcgccgggccg
gtccacctgccaaccccgcccggggtcgagcggatcgatgtcgagagcgcgctggagatg
gccgatgcagtggaggcggccttgcccgctgacgttgccgtcatggtcgccgccgtcgcc
gactggcgcgtttcgcgctcggccgaccagaagctcaagaaaaagaacggcgacggcccg
ccaactctcgagctgactgaaaaccccgatattctcgccacgcttgcaaaaagcgccggg
cgtccttcgctggtagtcggctttgccgcagagacgcaggacgtgatccgctacgcccgt
gaaaagcgcgtgcgcaagggcgccgactggatcatcgccaacgacgtgtcgggcgatgtc
atgggcggcgatgccaataccgtccacatcgtcaccgaaagcgatgtgatttctcttccc
gaaatgcccaaggaggatgtcgcgcgcatcctcgtcgaaaggttcgcagatgcactcccc
cgctga

DBGET integrated database retrieval system