KEGG   Novosphingobium sp. P6W: TQ38_003820Help
Entry
TQ38_003820       CDS       T05550                                 

Definition
(GenBank) inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
nov  Novosphingobium sp. P6W
Brite
KEGG Orthology (KO) [BR:nov00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    TQ38_003820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 DUF5531
Motif
Other DBs
NCBI-ProteinID: AXB75751
UniProt: A0A2Z5E827
Position
1:766758..767759
Genome map
AA seq 333 aa AA seqDB search
MEHSLALPLLFGLVALALAFDFLNGLHDAANAIATVVATRLLSPVVAVLFAAAGNFAAYF
FMGLHVAETVGKGIINVDAVTPSVVFGALVGAMFWNVLTWIKGIPSSSSHALIGGLLGAG
IAHGGFAVVESSGTIKTIAAIFVSPVLGFAIAMLMMLVTSWLFRGVSPRQSNGAFKSLHL
LSSAAYSISHGGNDAQKTMGIIAVLLYSTGHMTGEFHVPEWVVLSCYLAISLGTLSGGWK
IIKTMGSKLTKLNHHSGFCASTAGSIVVFGASALGIPVSTTHAITGSIVGTGAARRASAV
RWSVASRVIVAWFITIPASAAVGALFYTITRAF
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atggaacacagtcttgccctgccgctgctgttcggcctcgtcgcactggcgctggcgttc
gacttcctgaacggcctgcatgacgctgccaacgccatcgcgaccgtggtggcgacgcgg
ctgctgtcgccggtggtggcggtgctgtttgcggcagcgggcaatttcgcggcctatttc
ttcatggggctgcatgtcgccgagacggtcggcaagggcatcatcaacgtcgatgcggtg
accccttctgtagtgttcggggcgctggtgggcgcgatgttctggaacgtgctgacctgg
atcaagggcattccctcaagctccagccacgcgctgatcggcggcctgctgggcgccggg
atcgcccacggcggcttcgcggtggtcgaaagttccggcacgatcaagacgatcgcggcc
atcttcgtgtcgccggtgctgggctttgccatcgccatgctgatgatgctggtgaccagc
tggctgttcaggggcgtgtcgccgcgccagtcgaacggcgcgttcaagagcctgcacctg
ctgtccagcgccgcctattcgatcagccacggcggcaacgatgcgcaaaagacgatgggt
atcatcgcggtgctgctctattccaccggccacatgaccggcgagttccacgtgccggaa
tgggtggtactgtcgtgctatctggcgatttcgctgggcacgctgtcgggcgggtggaag
atcatcaagacgatgggctccaagctgaccaagctcaaccaccactcgggcttctgcgct
tccaccgccgggtcgatcgtggtgttcggcgccagcgcgctgggcatcccggtttcgacc
acccatgcgatcaccggctcgatcgtcggcaccggcgccgcgcgccgcgccagcgccgtg
cgctggtcggtggcgagccgggtgatcgtggcgtggttcatcaccatcccggccagcgct
gcagtgggtgcgctgttctatacgatcacgcgggcattctga

DBGET integrated database retrieval system