KEGG   Novosphingobium sp. P6W: TQ38_004460Help
Entry
TQ38_004460       CDS       T05550                                 

Definition
(GenBank) glycosyl hydrolase
  KO
K05349  beta-glucosidase [EC:3.2.1.21]
Organism
nov  Novosphingobium sp. P6W
Pathway
nov00460  Cyanoamino acid metabolism
nov00500  Starch and sucrose metabolism
nov01100  Metabolic pathways
nov01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nov00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    TQ38_004460
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    TQ38_004460
Enzymes [BR:nov01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     TQ38_004460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3_C Glyco_hydro_3 Fn3-like
Motif
Other DBs
NCBI-ProteinID: AXB75860
UniProt: A0A2Z5E8D5
Position
1:889099..891318
Genome map
AA seq 739 aa AA seqDB search
MTLRTSLFLAGACAALAAGASGAQDKATLDKGGQAASAKAEKTLQAMQTEEKTILTHGIM
PLKLTPDAPEPPAVAIPGAGYIPGIPRLGVPALFETDASLGVSYVFGVRKDGATALPSGL
AQAATWNPALIEEGGRMIGSETRAKGFNVLLAGGVNLMRDPRNGRNFEYLGEDPLLAGTL
AGHAIRGIQSNHIISTIKHFALNGQETGRKVVDSKISAANAHESDLLAFKIGIEIGDPGS
VMCAYNKVNGHSACDNDWLLNKVLKQDWGYKGFVMSDWGAVPSLGAALNGLDQQSGEQLD
KEVFFADKLAAAAKGDPAYAKRLDDMNRRILWAIYDNGLDANPAKPGGAIDFKTHGDIAE
QVARQGIVLLRNERDVLPLAASARRIAVIGGYANSGVLSGAGSSQVQAEGGPAVYIPAGN
GDENSPFIAESYHSSVPLKALREAAPQAEIHYRNGRYIAEAVAQAKKSDVAIVFATQWTS
EGFDVPDMSLPNGQDDLIAAVAAVNPNTIVVLETGGPVMMPWLGSTAAVIEAWYPGARGA
EAIAAVLTGKVNPSGKLPITFPAGKEQLPRAEVDGLDSTEPSFFGMPDMKGQPLVADYDI
EGANVGYRWNAVKGQKALFPFGYGLSYTRFAASGLKTDGTRASARMTNTGKREGATVAQL
YLVSRGGKPVQRLLGFQRVELTAGQSKPVAMTIDQRLLADWQDGNWTVVPGDYGFALGED
AEHLGPVMTVRLKGKTWQD
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
atgactcttcgcacttcgcttttccttgccggcgcgtgcgcggcgctggctgccggggct
tccggtgcgcaggacaaggccacgctggacaagggtgggcaagccgcatcggccaaggcg
gaaaagacgctgcaggcgatgcaaacggaagaaaagacgatcctgacgcatggcatcatg
cccctcaagctgacgcccgatgcgcccgaaccgcccgcagtggcgatcccgggggcgggc
tacattcccggcattccgcgccttggcgtgccggccctgttcgaaaccgatgccagcctc
ggcgtttcctacgttttcggcgttcgcaaggacggcgccaccgcgctgccttccggcctg
gcgcaggctgccacctggaacccggcgctgatcgaggaaggcggccggatgatcggctcc
gaaactcgtgccaagggtttcaacgtactgcttgccggcggcgtcaacctgatgcgcgat
ccgcgtaacggtcgcaatttcgagtatctgggcgaagatccgctgctggccggaactctc
gctggtcatgccatccgcggcatccagtccaatcacatcatttccaccatcaagcacttc
gcgctcaacggtcaggaaacaggccgcaaggtggtggacagcaagatcagcgccgccaat
gcgcatgaaagcgatctgctggccttcaagatcggcatcgagatcggcgatcccggctcg
gtcatgtgcgcctacaataaggtcaacggacattcggcctgcgacaacgactggttgctc
aacaaggtgctcaagcaggactggggctacaagggcttcgtcatgtccgactggggcgcg
gtgccctcgctcggcgctgcgctcaacgggcttgaccagcaatcgggagagcagctcgac
aaggaagtattctttgccgacaagctggcggctgcagccaagggggacccggcctatgcc
aagcggttggacgacatgaaccgccgtatcctctgggcgatctacgacaatggcctcgat
gcgaacccggccaagcccggcggtgcgatcgacttcaagacgcatggcgacatcgccgaa
caagtggcgcgccagggtatcgtcctgctgcgcaacgagcgcgatgtcctgcccctcgcc
gcgtcggccaggcgtatcgcagtgatcggcggttatgccaattcgggtgtgctgtcaggc
gccgggtccagtcaggtgcaagccgagggcgggcctgccgtctatatcccggcaggcaac
ggcgatgagaactcgccgttcatcgccgaatcctatcacagttcggttccgctcaaggcc
ttgcgcgaagcggccccccaggcggaaatccactatcgcaacggccgctacatcgccgaa
gccgtggcgcaggcgaagaaatccgacgttgcgatcgtatttgccacccagtggaccagc
gaagggttcgacgttcccgacatgagcttgcccaacggtcaggatgacctgatcgcggcg
gtcgccgctgtcaatccgaacaccatcgtggtgctggaaaccggcggtcccgtcatgatg
ccatggcttggcagcactgcggccgtgatcgaagcatggtatcccggcgcgcgcggcgca
gaagctatcgcagcggtgctgaccggcaaggtcaatccctcaggcaagctgccaatcact
ttcccggcgggcaaggagcaactgccgcgcgccgaagtcgatggactggacagcaccgaa
cccagcttcttcggcatgcccgatatgaagggtcagccgctggtcgctgactacgacatc
gaaggggccaacgtcggctatcgctggaacgcggtgaagggtcagaaggcgttgttcccg
ttcggttacgggctgtcttatacccgcttcgctgccagcggtctgaagaccgacggcacc
cgggctagcgcccgtatgactaacaccggcaagcgtgagggcgccacggtggcccagctc
tatctcgtctcgcgcggcggcaagccggtgcagcgtttgcttggcttccagcgggtggaa
ctgacggccgggcagagcaagccggtggccatgaccatcgaccagcgcctgctggccgac
tggcaggacggcaactggaccgtcgtgcccggcgattacggctttgcgctgggcgaggat
gccgaacacctcggcccggtcatgaccgtgcgcctcaagggcaagacctggcaagactga

DBGET integrated database retrieval system