KEGG   Novosphingobium sp. P6W: TQ38_016215Help
Entry
TQ38_016215       CDS       T05550                                 

Definition
(GenBank) SDR family NAD(P)-dependent oxidoreductase
  KO
K05886  serine 3-dehydrogenase (NADP+) [EC:1.1.1.276]
Organism
nov  Novosphingobium sp. P6W
Brite
KEGG Orthology (KO) [BR:nov00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    TQ38_016215
Enzymes [BR:nov01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.276  serine 3-dehydrogenase (NADP+)
     TQ38_016215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short adh_short_C2 KR Epimerase
Motif
Other DBs
NCBI-ProteinID: AXB77858
UniProt: A0A2Z5EEV5
Position
1:3370558..3371307
Genome map
AA seq 249 aa AA seqDB search
MKTAFITGATSGIGEACTRAFIGAGWRVVGTGRRAARLQALTDEFGAERFHACAYDVRDE
AARDAALGVLPEAFAAIDCLVNNAGLALGGTKAQESDVANWKIMIDTNVVALASLTHKLL
PGLIERKGAIVMLSSVAATYPYTGGNVYGGTKAFVRQFALGLRSDLSGTGVRVTSIEPGM
VETEFTVVRNGGDQQASDTLYSGVNPLTGGDIAETVLWVATLPAHVNINTLEVMPVNQSF
AGFQVAREG
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccgcattcatcaccggcgccacctccgggatcggcgaagcctgcacccgcgct
ttcatcggcgccggctggcgcgtggtcggcaccggacgccgcgcggcgcgtcttcaggca
ctgaccgatgaattcggcgcggaacgcttccacgcctgcgcatacgacgtgcgcgacgaa
gccgcccgcgatgccgcgctcggcgtcctgcccgaagccttcgccgcgatcgattgcctg
gtgaacaacgccggcctcgcactgggcgggaccaaggcgcaggaatcggacgtcgccaac
tggaagatcatgatcgacaccaacgtggtcgcgcttgcctcgctcacgcacaagctgctg
ccgggcctgatcgaacgcaagggtgcgatcgtgatgctctcctccgttgcggccacctac
ccctacaccggcggcaacgtctacggcggcaccaaggccttcgtgcgccagtttgcgctg
ggcctgcgctcggacctgtcgggaacgggcgtgcgcgtcacctcgatcgagccgggcatg
gtcgagaccgaattcaccgtcgtgcgcaacggcggcgatcagcaggcttcggacacactg
tattcgggcgtcaacccgctgaccggcggtgacattgccgaaaccgtgctgtgggtcgcc
acgctgccggcgcacgtcaatatcaacacgcttgaagtgatgccggtgaaccagtcgttt
gcagggtttcaggtggctagggaaggctaa

DBGET integrated database retrieval system