KEGG   Novosphingobium sp. P6W: TQ38_020660Help
Entry
TQ38_020660       CDS       T05550                                 

Definition
(GenBank) aldehyde dehydrogenase (NADP(+))
  KO
K13877  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
nov  Novosphingobium sp. P6W
Pathway
nov00040  Pentose and glucuronate interconversions
nov00053  Ascorbate and aldarate metabolism
nov01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nov00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    TQ38_020660
   00053 Ascorbate and aldarate metabolism
    TQ38_020660
Enzymes [BR:nov01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     TQ38_020660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh KAAG1
Motif
Other DBs
NCBI-ProteinID: AXB78981
UniProt: A0A2Z5EH52
Position
2:984322..985893
Genome map
AA seq 523 aa AA seqDB search
MINGAILIGRSELHTESGYRAINPATGETLEPAFTTAGLPEVERACALADQAAIPFAELN
PETRAVFLETISDQIMEIGDQLIERAMAETGLPRARLEGERGRTTGQLRLFAQVLREGSW
AGLTIDPALPQRTPLPRPDLRVRKVALGPVVVFGASNFPLAFSVAGGDTASAFAAGCPVI
VKGHSAHPGTGELVARAVQRAVALCHLPEGTFSYLPATREAGTALVADHRVKAVGFTGSR
PGGTALMRTAAARAEPIPVYAEMSSINPVVLFPAALEARGEALGAAFVQSLTLGAGQFCT
NPGLVIAIDGPALDTFLASAAETMGASAAQDMLTPGIHSAFAQGVEALAGHGAVTTLARG
LEPKGPHQAQGALFKTAAADFLADPALGAEVFGSSSLVITVADMDEATCVIAALEGQLTA
TLILDAEDEPLVARLLPTLERKVGRILVNGWPTGVEVCHAMVHGGPFPSTSDGRTTSVGA
MAIERFLRPVCYQNMPTALLPEGLDDANPWKAPRRIDGVLKLA
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgatcaacggcgccatcctcatcggccgcagcgaacttcataccgaatccggctaccgt
gccatcaacccggcgacaggcgagacgctggaaccggccttcacaaccgctggtctgccc
gaagtcgagcgcgcctgcgcgctggccgaccaggcggcgatccccttcgccgaactcaac
ccggaaacccgcgcggtcttcctcgagactatctccgaccagatcatggaaatcggcgac
cagctgatcgagcgcgccatggccgagaccggcctgccccgcgcccgcctcgaaggcgag
cgtggccggaccaccggccagctgcgcctcttcgcgcaagtcctgcgcgaaggcagctgg
gccggactgacgatcgacccggccctgccccagcgcacgcccctgccccgcccggacctg
cgcgtgcgcaaggtcgcgctaggcccggtcgtcgtgttcggcgccagcaacttcccgctc
gccttctcggtggcgggcggcgataccgcttcggcctttgccgccggttgcccggtcatc
gtcaagggccactccgcgcatcccggaaccggcgaactcgtcgcgcgcgccgtccagcgg
gccgtggcgctctgccacttgcccgagggcacgttctcctacctccccgccacgcgtgag
gcagggaccgcgctcgtcgccgaccaccgcgtcaaggcggtcggcttcaccggctcgcgc
cccggcggcacggcgctgatgcgcaccgccgccgcccgcgccgagccgatcccggtctat
gccgagatgagttcgatcaatccggtggtcctgttccccgccgctctcgaggcccgcggc
gaggcactcggcgccgctttcgtgcagtcgctgacgctgggcgcgggccagttctgcacc
aaccccggcctcgtgatcgcgattgacggcccggcgctggacaccttcctcgcctctgcc
gccgagacgatgggcgccagcgccgcgcaggacatgctgacaccgggcatccactctgcc
ttcgcgcagggcgtcgaggcgctggcgggccacggcgccgtcaccacgcttgcgcggggg
ctcgaacccaaggggccgcatcaggcgcagggcgcgctgttcaagaccgccgccgccgac
ttcctcgccgacccggcactcggcgccgaagtgttcggctcctcctcgctcgtcatcacc
gtcgctgacatggacgaggcaacctgcgtaatcgccgcgctggaaggccagctgaccgcc
acgctgatcctcgacgccgaggacgagccgctggtggccaggctgctgccgacgctggag
cgcaaggtcggccgcatcctcgtcaacggctggccgaccggtgtcgaggtatgccacgcg
atggtccacggcgggccgttcccctccacctcggatgggcgcaccacctcggtcggcgcc
atggcgatcgagcgtttcctgcgcccggtctgctaccagaacatgcccacggcgctgctg
cccgagggcctggacgacgccaatccctggaaagccccgcgccgcattgacggcgtgctc
aagctcgcctga

DBGET integrated database retrieval system