KEGG   Novosphingobium sp. P6W: TQ38_025300Help
Entry
TQ38_025300       CDS       T05550                                 

Definition
(GenBank) alkaline phosphatase
  KO
K01113  alkaline phosphatase D [EC:3.1.3.1]
Organism
nov  Novosphingobium sp. P6W
Pathway
nov00790  Folate biosynthesis
nov01100  Metabolic pathways
nov02020  Two-component system
Module
nov_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:nov00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    TQ38_025300
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    TQ38_025300
Enzymes [BR:nov01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     TQ38_025300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PhoD PhoD_N Pur_ac_phosph_N
Motif
Other DBs
NCBI-ProteinID: AXB79741
UniProt: A0A2Z5EJ55
Position
2:2134162..2135781
Genome map
AA seq 539 aa AA seqDB search
MTLNLDRRLLLRAGAFGLAALSTPGVAQILTARGFTHGVASGEPAPHSVLLWTRYVGSGD
TKLRCELSEDETFRKIAGGGDVVASPAHDNCAKLVVKGLAPGKWYNYRFIAPDGSMSDVG
RTRTLPVGEVDRFGIGLFSCSNMPFGWFNAYAHAAARDDLDLVVHVGDYFYEYEYGHYPE
NPMAGRMIEPANETVTLADYRLRFASYRLDPDLRRLHQRFPMIAQWDDHELANDAWKDGA
ENHQSDKEGSWSVRKADAEKAYREWMPVSDAVYDSFEIGSLATVFRPETRITARSQQLDF
GSVMAGKADIAKALADFRDGPWMAADRTLMGAKQEAWLHGALAKSAKSGTRWQVLAQQVV
MGSLKAPVQMGDLVPADGDPKVRQALMAIAAAAKAGLPFNMDSWDGYPAARERLLRAARE
ADCNLVVLSGDSHNAWGNELAIEGAAAGVEYAGHSVTSPGYETYLPALPPAELAKALRGA
NPGLAFADTSRRGYVSLDLTPDQVRGQWHFMGTIARHTIDGTTSEGLSVKWNERRFSKA
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgacgctaaatctcgatcgccgtctgctgcttcgcgcgggcgccttcggccttgccgcg
ctttccacgcccggcgtcgcccagatccttaccgcgcgcggtttcacgcacggcgttgcc
agcggcgagccggcaccgcactcggtgctgctgtggacccgttatgtcggcagcggcgac
acgaagctgcgctgcgaactgtccgaggacgagactttccgcaagatcgcgggcggcggc
gatgtggtcgcctctccggcgcatgacaactgcgccaagctggtggttaagggcctcgcg
cccggcaaatggtacaattaccgcttcatcgctcccgacggcagcatgagcgacgtcggc
cgcactcgcaccctgcccgtgggcgaggtcgaccggttcggcatcggcctgttctcctgc
tcgaacatgccgttcggctggttcaacgcatatgcccatgccgccgcgcgcgacgatctt
gatctcgtggtccacgtcggggactatttctacgagtacgaatacggccactatcccgaa
aacccgatggccgggcgcatgatcgaacctgccaacgaaacggtgacgctggccgattat
cgcctgcgctttgccagctatcgcctcgacccggacctgcgccgcctgcaccagcgcttt
ccgatgatagcgcagtgggatgatcacgaactggccaatgacgcctggaaggacggcgcc
gaaaaccaccaaagtgacaaggaaggttcctggtccgtccgcaaggcagacgcagaaaag
gcgtaccgggaatggatgccggtatccgatgcggtctacgacagcttcgagatcggttcg
ctggcgacggttttccgcccggaaacccgcataaccgcgcggagccagcagttggacttc
ggatcggtgatggccgggaaggcggacatcgccaaggccctggctgacttccgcgatggc
ccgtggatggctgccgaccgcaccctgatgggcgccaaacaggaagcatggctccacggt
gcactggcgaaatccgcaaagtccggcacgcgctggcaggtgcttgcccagcaggtggtg
atgggctccctgaaggccccggtgcagatgggcgacctggttccggcagacggcgacccc
aaggtccggcaggcgctcatggccatcgctgctgcggcgaaggccgggctcccgttcaac
atggattcctgggatggctaccccgccgcacgcgaacgcctgctgcgcgctgcccgcgag
gccgattgcaacctcgtcgtgctctcgggcgacagccacaatgcatggggcaacgaactg
gcgatcgaaggggctgcggccggcgtcgaatatgcagggcactcggtcacttctccgggc
tacgaaacctatctgccggcgctgccgcctgccgaactggccaaggcgctgcgcggcgcg
aaccctggattggccttcgccgataccagtcgccgcggctatgtttcgctggacctgaca
ccggatcaggtgcgcggtcagtggcacttcatgggcaccattgcccgccacaccatcgac
ggcacgaccagcgagggcctttccgtaaaatggaacgagcgccgcttctccaaggcgtaa

DBGET integrated database retrieval system