KEGG   Novosphingobium sp. P6W: TQ38_027130Help
Entry
TQ38_027130       CDS       T05550                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
nov  Novosphingobium sp. P6W
Pathway
nov00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:nov00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    TQ38_027130
Enzymes [BR:nov01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     TQ38_027130
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     TQ38_027130
    1.1.1.-  
     TQ38_027130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C NAD_binding_7 TPMT
Motif
Other DBs
NCBI-ProteinID: AXB80261
UniProt: A0A2Z5EKM7
Position
pP6W1:complement(307428..308450)
Genome map
AA seq 340 aa AA seqDB search
MRAAVFRGAGSPLSIETVPDPEPHSGRIVLAVERSGICGSDLHMAQSAHTPQGLILGHEF
AGSIVAMGSDVAGGWKQGDRVTALPLNACNSCTTCERGLFALCSQNLFTGTSLLAQGAYA
EFVSVRPDMLQHLPANVGFDEGAMVEPLAVGHHVVSMAALPHHTSVLVPGCGPIGIAVVL
FALRAGARHVVVSERSAERRALAMAIGASAAIDPEAVDVAQAFAAKSLGTRPHVVFECVG
VPGMLRQAIDLVDVRGQVIVAGVVLQEETFLPLAALGKEVTIRYSQAYTEADFEAVIGAL
ARGEIEAKPIHTSTVDLNELPAAFAALAKQPNQCKVLIRP
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgctgcagttttccggggtgcaggctcgccgctttcgatcgagaccgttcccgac
cccgagccgcattccggccggatcgttctggcggtcgaacggtccgggatctgcggatcc
gacctgcacatggcgcagagcgctcataccccccagggtctgatcctggggcatgagttc
gccggctccattgtggcgatgggtagcgatgtggccggcggctggaagcagggagaccga
gtaactgcgcttcccctcaatgcctgcaacagctgcacgacatgtgagcggggactgttc
gcgctatgctcgcagaacctcttcacaggcacgtccctgttggcgcagggcgcttatgcc
gagttcgtgagcgtcaggccggacatgctgcaacaccttccggcgaatgtcggattcgac
gaaggcgccatggtggagccgcttgctgtcgggcatcatgtcgtctcaatggcggccttg
ccacatcacacctccgtcctagtccccggctgcgggcctatcgggattgccgtcgttctg
ttcgcgttgcgggcgggtgcgcgccatgtcgtcgtcagtgagcgctcggcggagcgccgc
gcgctagccatggcgatcggcgccagcgcggcaatcgaccctgaagccgtggacgtggcg
caggctttcgccgccaagagcctaggcacccgcccgcacgtcgtcttcgaatgcgtgggt
gtgcccggcatgctgcggcaggcaatcgacctagtcgatgtgcgcgggcaggtgattgtc
gcgggtgtcgtgctacaggaggagaccttcctacccctcgccgcgcttgggaaggaagtg
acgatccgctacagtcaggcctataccgaagcggattttgaagcggtgatcggcgcgctg
gcccggggcgagatcgaagcaaagccgatccacacctcgacagtggatttgaacgagtta
ccggctgcctttgccgcgctcgcgaagcagccgaaccagtgcaaggtcctgatccggccc
tga

DBGET integrated database retrieval system