KEGG   Novosphingobium sp. P6W: TQ38_027285Help
Entry
TQ38_027285       CDS       T05550                                 

Definition
(GenBank) alpha/beta fold hydrolase
  KO
K16050  4,5:9,10-diseco-3-hydroxy-5,9,17-trioxoandrosta-1(10),2-diene-4-oate hydrolase [EC:3.7.1.17]
Organism
nov  Novosphingobium sp. P6W
Pathway
nov00984  Steroid degradation
nov01100  Metabolic pathways
nov01120  Microbial metabolism in diverse environments
nov01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:nov00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    TQ38_027285
Enzymes [BR:nov01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.17  4,5:9,10-diseco-3-hydroxy-5,9,17-trioxoandrosta-1(10),2-diene-4-oate hydrolase
     TQ38_027285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 DLH Esterase
Motif
Other DBs
NCBI-ProteinID: AXB80289
UniProt: A0A2Z5EKN1
Position
pP6W1:338483..339307
Genome map
AA seq 274 aa AA seqDB search
MTSELSRRVQTVSDGHEISIAERGEGPAVVFIHGSGPGASGASNFRENVQAFVDAGYRVI
LPDLVGYGQSSKPDGIDYPLELFTRTLVEALALHGVRGGSLVGNSLGGGIALQIALDHPE
FAVDKLILMAPGCVAEQASYFTMPGIAKMRSGFGSPDFNVEEQRRLIGNLMHPDSLHRVT
DTLVQERFEVARTQSRDVIGRMKTPNLGPRLSEVETPVFVLWGLDDAFCPEAHARLFLES
CPDVRCMTFGRTGHWVQVERAEEFNRYSVDFLRG
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgacgagcgaattgtcgcgccgagttcagacggtctcggacgggcacgagatttccatc
gccgaacggggcgaaggcccggccgtggtcttcatccacggaagcgggccgggcgcttct
ggtgcatcgaatttccgtgaaaacgtgcaggcgttcgtcgatgccggttaccgggttatc
ctgcccgacctcgtcggctacggacaatcatccaagcccgacgggatcgattatcctctg
gagctgttcacccgcacgctggtcgaggcactggctctgcacggggttcgcggcggtagc
ctcgtcggcaactcgctcgggggcggcatcgccttgcagatcgcgctcgatcatcccgag
ttcgccgtagacaagctgatcctgatggcgccgggctgcgttgccgagcaggcgagctac
ttcacgatgccgggtatcgcgaagatgcgctcgggtttcggcagtcccgattttaacgtg
gaggagcagcgccgcctgatcggcaatctcatgcatcccgattcgctgcaccgcgtgact
gatacgctggtgcaggagcgtttcgaagtcgcccgcacgcagtcgcgcgatgtgatcgga
cgcatgaagacgccgaacctcggaccgcgcctgagcgaagttgaaacccccgtcttcgtt
ctatggggtctggacgacgccttctgccccgaggcgcacgcgcggctgttcctcgaatcc
tgcccggacgtacgctgcatgacgttcgggcgaaccgggcactgggtccaggtggagcgg
gcggaagagttcaaccgctattcggtggacttcctccgtggctag

DBGET integrated database retrieval system