KEGG   Nocardioides sp. MMS17-SY117: EXE57_14610Help
Entry
EXE57_14610       CDS       T05931                                 

Definition
(GenBank) inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
noy  Nocardioides sp. MMS17-SY117
Brite
KEGG Orthology (KO) [BR:noy00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    EXE57_14610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: QBR93357
UniProt: A0A4P7GNK1
Position
complement(3045114..3046118)
Genome map
AA seq 334 aa AA seqDB search
MELAIIVAVVVVALVFDYTNGFHDAANAIATSVSTRALTPRVALAMAAVMNFVGAFLGQE
VASTVSETINPGAGTHGLVIVMSGLLGAITWNIITWYYGLPSSSSHALIGGLVGAAVAAG
ATANWDVVVSKVVIPMFLSPVVAFGLGFLVMLGIMWAFRRANPGRAQRGFRIAQTVSAAA
MALGHGLQDAQKTMGVIFLALLTGDYVSPGDDLPLWVIFSAAAAISLGTYSGGWRIMRTL
GRRIIHLDPARGFAAESVAASVLYTTAYAFEAPISTTHTITSAVMGVGATKRLSAVRWGV
ARSILIAWVLTFPMAGLAAAACYWLSHLFIEVLP
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atggaactcgcgatcatcgtcgcggtggtcgtcgtcgccctcgtcttcgactacacgaac
ggcttccacgacgccgccaacgccatcgccacctcggtctcgacccgagcgctgaccccg
cgggtggcgctggcgatggccgccgtcatgaacttcgtcggcgccttcctgggccaggag
gtcgccagcaccgtctccgagacgatcaaccccggagcgggcacgcacggcctggtgatc
gtgatgtcgggcctgctcggcgcgatcacctggaacatcatcacctggtactacggcctc
ccgtcgtcgtcctcccacgccctcatcggcggcctggtcggcgccgccgtcgcggccggt
gcgaccgcgaactgggacgtcgtggtgtccaaggtcgtgatcccgatgttcctgtcgccg
gtcgtcgccttcgggctcggcttcctggtgatgctcggcatcatgtgggccttccggcgc
gccaaccccggtcgcgcccagcgcggcttccgcatcgcccagaccgtctccgccgccgcg
atggccctgggccacggcctgcaggacgcccagaagacgatgggcgtgatcttcctggcg
ctgctcaccggcgactacgtctcccccggcgacgacctcccgctctgggtgatcttctcg
gccgcggccgcgatctcgctcggcacctactccggcggctggcggatcatgcggaccctc
ggccgccggatcatccacctcgaccccgcccgcgggttcgccgcggagagtgtcgctgcg
tcggtgctctacaccacggcgtacgccttcgaggcgccgatctcgaccacccacaccatc
acctccgcggtgatgggcgtcggcgccaccaagcgcctctcggcggtccggtggggggtc
gcgcgctcgatcctcatcgcctgggtgctgaccttcccgatggccggtctcgccgccgcg
gcgtgctactggctcagccacctgttcatcgaggtcctgccctga

DBGET integrated database retrieval system