KEGG   Nocardioides sp. MMS17-SY117: EXE57_17730Help
Entry
EXE57_17730       CDS       T05931                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
noy  Nocardioides sp. MMS17-SY117
Pathway
noy00450  Selenocompound metabolism
noy00970  Aminoacyl-tRNA biosynthesis
noy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:noy00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    EXE57_17730
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    EXE57_17730
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:noy01007]
    EXE57_17730
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:noy03016]
    EXE57_17730
Enzymes [BR:noy01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     EXE57_17730
Amino acid related enzymes [BR:noy01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   EXE57_17730
Transfer RNA biogenesis [BR:noy03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    EXE57_17730
 Prokaryotic type
   Other AARSs
    EXE57_17730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 Phage_tail_L tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: QBR93918
UniProt: A0A4P7GNW9
Position
3650549..3652348
Genome map
AA seq 599 aa AA seqDB search
MTHVLSAVAWPYANGPRHIGHVAGFGVPSDVFSRYMRMAGHDVLMVSGTDEHGTPILVTA
DKEGVSARDLADKNNAVIVTDLVDLGLSYDLFTRTTTGNHYRVVQEMFRTCHRNGYMVEQ
TTQSAISPSTGRTLPDRYIEGTCPICKYADARGDQCDNCGNQLDPTDLIDPRSKINGETP
EFVETQHFFLDLPALAEALGEWLDEREASGTWRPNVIKFSQNILKEIRPRAMTRDIDWGI
PVPGWEDQPTKRLYVWFDAVIGYLSASIEWARRLGEPDRWRDWWNDPEARSYYFMGKDNI
VFHSQIWPAELLAYDGRGSRGGEPGDYGVLQLPTEVVSSEFLTMGDQQFSTSRGHVLYVG
DFLARYGPDPLRYFICAAGPETSDAAFTWADFVTRNNSELVAGWGNLVNRTATMISKNFG
EIPPCGDLEPVDEAVLAKVRAGFDTVGDLLAHHRLRAATAEAMRVVGEVNRYLTVTEPYK
MKDESQRERLATVLHVAAQCVSDCNTLLSPFLPHSANKVHLVLGGEGEFMPMPRVDQVDE
LEPDHGAGLTSYPVITGDYSGTPAWESRPVRVGATVAKPTPVFTKLDPSIIDEELARLG
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atgacccatgtcctgtctgccgtcgcctggccgtacgccaacggcccgcgccacatcggc
cacgtggccggtttcggcgttccctccgacgtgttcagccggtacatgcggatggcgggc
cacgacgtgctcatggtctccgggaccgacgagcacggcaccccgatcctggtcaccgcc
gacaaggagggcgtcagcgcccgcgacctcgccgacaagaacaacgccgtgatcgtcacc
gacctggtcgacctcgggttgtcgtacgacctcttcacccgcaccaccaccggcaaccac
taccgggtcgtgcaggagatgttccgcacctgtcaccgcaacggctacatggtcgagcag
acgacgcagtcggcgatcagtccctcgaccggccggacgttgcccgaccgctacatcgag
ggcacctgcccgatctgcaagtacgccgacgcgcgcggcgaccagtgcgacaactgcggc
aaccagctcgaccccaccgacctgatcgacccgcgcagcaagatcaacggcgagacgccc
gagttcgtcgagacccagcacttcttcctcgacctgcccgcgctcgcggaggcgctgggg
gagtggctcgacgagcgcgaggcgtcgggcacgtggcgtcccaacgtcatcaagttcagc
cagaacatcctcaaggagatccggcctcgcgcgatgacgcgcgacatcgactggggcatc
ccggtgccgggttgggaggaccagccgaccaagcggctctacgtctggttcgacgccgtc
atcggctacctctcggcctccatcgagtgggcgcgccggctcggcgagcccgaccggtgg
cgcgactggtggaacgatcccgaggcccgctcctactacttcatgggcaaggacaacatc
gtcttccactcccagatctggcccgcggagctgctggcctacgacgggcgcgggagccgg
ggcggcgagcccggcgactacggcgtgctccagctccccaccgaggtcgtgtcctcggag
ttcctcaccatgggcgaccagcagttctccacctcgcgcggccacgtcctgtacgtgggt
gacttcctggcccgctacggccccgacccgctgcgctacttcatctgcgcggccgggccc
gagacctccgacgcggccttcacctgggccgacttcgtcacccgcaacaactccgagctg
gtcgccgggtggggcaacctggtcaaccgcacggcgacgatgatctccaagaacttcggg
gagatcccaccctgcggcgacctcgagccggtcgacgaggcggtgctggccaaggtccgc
gcgggcttcgacactgtcggcgacctgctcgcccaccaccggctgcgggcggccaccgcc
gaggcgatgcgggtcgtcggcgaggtcaaccgctacctcaccgtcaccgagccctacaag
atgaaggacgagtcgcagcgcgagcggctggcgaccgtgctgcacgtcgcggcgcagtgc
gtcagcgactgcaacacgctgctctcgcccttcctgccgcactccgccaacaaggtccac
ctggtgctcgggggcgagggcgagttcatgccgatgccgcgggtcgaccaggtcgacgag
ctcgagcccgaccacggggccggactgacgtcgtacccggtcatcaccggcgactactcc
ggcacgccggcctgggagtcgcggccggtccgggtcggggccacggtggcgaagccgacg
ccggtcttcaccaagctggacccctccatcatcgacgaggagctggcccggctgggctga

DBGET integrated database retrieval system