KEGG   Nocardia sp. CS682: DMB37_11495Help
Entry
DMB37_11495       CDS       T06040                                 

Definition
(GenBank) steroid 3-ketoacyl-CoA thiolase
  KO
K00632  acetyl-CoA acyltransferase [EC:2.3.1.16]
Organism
noz  Nocardia sp. CS682
Pathway
noz00071  Fatty acid degradation
noz00280  Valine, leucine and isoleucine degradation
noz00281  Geraniol degradation
noz00362  Benzoate degradation
noz00592  alpha-Linolenic acid metabolism
noz01100  Metabolic pathways
noz01110  Biosynthesis of secondary metabolites
noz01120  Microbial metabolism in diverse environments
noz01130  Biosynthesis of antibiotics
noz01212  Fatty acid metabolism
Module
noz_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:noz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    DMB37_11495
   00592 alpha-Linolenic acid metabolism
    DMB37_11495
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    DMB37_11495
  09109 Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    DMB37_11495
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    DMB37_11495
   00642 Ethylbenzene degradation
    DMB37_11495
Enzymes [BR:noz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     DMB37_11495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Transketolase_C ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: QBS40656
UniProt: A0A4V1BFN6
Position
2559057..2560226
Genome map
AA seq 389 aa AA seqDB search
MRSAVIVDVVRTPSGKGKVGGGLSGVHPATLLAGVLTELVARNGLDPALIDDVVGGCVTQ
SGEQAFNISRTAALAAGFPESVPATTVDRQCGSSQQAAHFAAQGVISGAYDIAIACGVES
MSRAPMFSNAQGKDANKGPLAHRYPEGLVQQGIAAEVISARWKFDRVTLDEFAARSHRLA
AETAAAGGFGSELVAAGTLTADETIRPTTTAEGLAGLKPAFVDDQFAQRFPEIEWSITPG
NSSPLTDGASAALIMSEEAANKLGLRPRARFHSFSVVGDDPLLMLTAVIPATRKVLERAG
LSIDDIDAYEVNEAFAPVPLVWQHELGADPAKLNPRGGAIALGHPLGASGTRILATMVNH
LEQTGGRYGLQTMCEAGGLANATIIERLG
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaggtccgccgtcatcgtcgatgtcgttcgtaccccgtcgggcaaggggaaggtcggg
ggtgggttgtcaggggtacatccggccaccttgctcgccggggtgctgaccgagttggtg
gcgcgcaacgggctggatccggcgctgatcgatgatgtggtcggcgggtgcgtgacgcag
agcggtgagcaggcgttcaacatcagcaggacggcggcgctggccgcggggttcccggag
tcggtgcccgcgacgacggtggaccggcagtgcggatcgagtcagcaggcggcgcatttc
gcggcgcagggggtgatctcgggggcgtatgacatcgcgatcgcctgcggcgtggagtcg
atgagccgggcgccgatgttctccaacgcccagggcaaagatgcgaacaagggtccgttg
gcgcatcggtatccggaaggtcttgtgcagcaaggcatcgcggccgaggtgatcagtgcg
cggtggaaattcgaccgggtcacgctcgacgagttcgcggcacgctcacaccggctcgcc
gcggaaacggccgcagcaggcggattcggaagcgagctggtcgccgcgggcaccttgacc
gcggacgagacgatccgccccacgaccaccgccgaaggcctggcgggactgaaacccgcg
ttcgtggacgaccagttcgcccagcggttcccggagatcgagtggtcgatcacgccgggc
aactcctccccgctgaccgatggcgcgtcggccgcgttgatcatgagcgaggaagccgcg
aacaagctgggtttacgtcccagggcgcggttccattccttctcggtggtcggcgacgac
ccactgctcatgctgaccgccgtcatcccggccacccgcaaggtgctggagcgggcaggc
ctgagcatcgacgacatcgacgcctatgaggtgaacgaggcgttcgccccggttccgctg
gtgtggcagcacgagctgggcgcggatccggccaagctgaacccgcgcggcggcgcgatc
gccctcggccaccccctcggcgcctccggcacccgtatcctggccaccatggtcaatcat
ctcgaacagaccggcggccgctatggcctgcaaaccatgtgcgaggcaggcggtttggcc
aacgccaccatcatcgagcgtctcggatga

DBGET integrated database retrieval system