KEGG   Nocardia sp. CS682: DMB37_16475Help
Entry
DMB37_16475       CDS       T06040                                 

Definition
(GenBank) ADP-forming succinate--CoA ligase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
noz  Nocardia sp. CS682
Pathway
noz00020  Citrate cycle (TCA cycle)
noz00640  Propanoate metabolism
noz00660  C5-Branched dibasic acid metabolism
noz01100  Metabolic pathways
noz01110  Biosynthesis of secondary metabolites
noz01120  Microbial metabolism in diverse environments
noz01130  Biosynthesis of antibiotics
noz01200  Carbon metabolism
Module
noz_M00009  Citrate cycle (TCA cycle, Krebs cycle)
noz_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:noz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DMB37_16475
   00640 Propanoate metabolism
    DMB37_16475
   00660 C5-Branched dibasic acid metabolism
    DMB37_16475
Enzymes [BR:noz01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     DMB37_16475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 GARS_A
Motif
Other DBs
NCBI-ProteinID: QBS41483
UniProt: A0A4P7H3X0
Position
complement(3635500..3636666)
Genome map
AA seq 388 aa AA seqDB search
MDLFEYQAKELFVKHGVPSSEGRVTDTAEDARAIAAEIGKPVMVKAQVKAGGRGKAGGVK
YAATPDDAFTHAQNILGLDIKGHITKKILVAEAKDIAEEYYISFLLDRSNRTYLAMCSVE
GGMEIEEVAATKPERLAKVAVDAVKGVDLAFARSIAEQGHLPAEVLDAAAVTIQKLWEVF
VKEDATLVEVNPLVRTPQDEILALDGKVTLDENAEFRHADHEAFADKDATDPLELKAKEN
DLNYVKLDGEVGIIGNGAGLVMSTLDVVAYAGEHHGGVKPANFLDIGGGASAEVMAAGLD
VILGDSQVKSVFVNVFGGITACDAVANGIVKALEILGAEANKPLVVRLDGNKVDEGRQIL
ADAAHPLITLAQTMDEGADKAAELAAAK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atggatctcttcgaatatcaggcgaaggagctcttcgttaagcacggagtgccttcgtcc
gagggccgcgtcacggacacggccgaggacgcccgcgccatcgcggcggaaatcggcaag
ccggtgatggtcaaggcccaggtgaaggccggtggccgcggcaaggcgggtggcgtcaag
tacgccgccaccccggacgacgcgttcacgcatgcgcagaacatcctcggcctggatatc
aagggccacatcaccaagaagatccttgtcgccgaagccaaggacatcgcggaggagtac
tacatctccttcctgctcgaccggtccaaccgcacctacctggccatgtgctcggtggaa
ggcggcatggagatcgaagaggtcgccgcgaccaagccggagcgcctcgccaaggtcgcc
gtcgacgccgtcaagggtgtcgacctcgctttcgcccgctcgatcgccgagcagggccac
ctgcccgccgaggtgctcgacgccgcggccgtgaccatccagaagctgtgggaggtgttc
gtcaaggaggacgccaccctggtggaggtcaacccgctcgtgcgcaccccgcaggacgag
atcctcgcgctggacggcaaggtcaccctggacgagaacgccgagttccggcacgcggat
cacgaggccttcgcggacaaggacgcgaccgatcccttggagctcaaggccaaggagaac
gacctcaactacgtcaagctcgacggtgaggtcggcatcatcggcaacggcgccggtctg
gtcatgtccaccctcgacgtggtcgcctacgcgggcgagcaccacggcggcgtcaagccc
gccaacttcctcgacatcggtggtggcgcctcggccgaggtgatggccgctggtctcgat
gtgatcctgggtgactcccaggtcaagagcgtgttcgtgaacgtcttcggtggcatcacc
gcctgtgacgcggtcgccaacggcatcgtcaaggcgctggagatcctcggcgccgaggcg
aacaagccgctggtcgtccgtctcgacggcaacaaggtggacgagggtcgccagatcctc
gccgatgccgcgcacccgctgatcacgcttgcgcagacaatggacgaaggcgccgacaag
gccgccgaactggcagcggccaagtaa

DBGET integrated database retrieval system