KEGG   Nocardia sp. CS682: DMB37_34870Help
Entry
DMB37_34870       CDS       T06040                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
noz  Nocardia sp. CS682
Pathway
noz00260  Glycine, serine and threonine metabolism
noz01100  Metabolic pathways
noz01110  Biosynthesis of secondary metabolites
noz01120  Microbial metabolism in diverse environments
noz01130  Biosynthesis of antibiotics
noz01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:noz00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DMB37_34870
Enzymes [BR:noz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     DMB37_34870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-ProteinID: QBS44501
UniProt: A0A4P7HD27
Position
complement(7664781..7665926)
Genome map
AA seq 381 aa AA seqDB search
MWSLRFRVVAVLIGTTELDGKISVADTAGTDAVRRHDPAVRGFASDNHAGIHPEVLAALT
LANGGHQIAYGGDEYTAHLQEIFAGHFGERATAYPVFNGSGANVVALQALLPRWGAVIAA
ESAHINVDECGAPEKLAGIKIHTVATPDGKLTPELIDRQAYGWGDEHRAQPSAVSVTQST
ESGTVYTADELRAICEHAHERDMLVHVDGARLANAAASLGVPLRAITTDVGVDVLSFGGT
KNGLLLGECVVVLDQEAVRDIRYLRKMSLQLASKMRFVSVQFEALLGGDLWLRSAAHANA
MAERLAAAVAGIDGVRIVRPVQANAVFAILPREVTERLQKRYRFYLWDERTGEVRWMCAF
DTTTDDVDSFAEAIADEMSRV
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgtggtcgctgcggttccgcgtcgtcgctgtactgatcggcacaaccgaactcgatggg
aaaatatccgtggctgacaccgccggcaccgacgccgttcgcaggcatgatcccgccgta
cgcggcttcgccagcgacaaccacgccgggattcaccccgaggtgctcgcggcgctgacc
ctggccaacggcggccatcaaatcgcctacggcggggacgagtacaccgcccacctccag
gaaattttcgccgggcacttcggcgagcgagccacggcgtacccggtattcaacgggtcc
ggtgccaacgtcgttgcgctgcaagcgctgctgccgcgctggggcgcggtgatcgcggcg
gagtccgcgcacatcaacgtggacgagtgcggcgcgccggagaagctcgccggaatcaag
atccacactgtcgccactcctgacggcaagttgacccccgaactgatcgaccggcaggcc
tacgggtggggcgacgagcatcgggcccagccctcggccgtgtccgtcacccagagcacc
gagtccggcaccgtgtacaccgccgatgaacttcgcgcgatctgcgaacacgcccacgag
cgggacatgctggtccatgtcgacggtgcccggctggccaacgcggccgcctcgctcggc
gtgccgttgcgcgcgatcaccacggatgtgggggtcgacgtgctgtcgttcggcggtacc
aaaaatggtctgctgctcggcgaatgtgtcgtggtgctcgaccaggaagccgtccgggat
atccgctatctgcgcaagatgtcgctgcaattggcgtcgaagatgcgtttcgtctcggtg
cagttcgaggcgctgctcggcggcgatctctggctgcgcagtgccgcgcacgccaatgcg
atggcagagcgcctcgcggccgcggttgccggtatcgacggtgtgcggatcgtgcgcccg
gtgcaagccaacgcggtcttcgcgattcttcctcgcgaagtgaccgagcgattgcagaag
cgttatcgcttctatctgtgggacgaacgcaccggcgaggtccgttggatgtgcgccttc
gacaccaccaccgacgatgtcgacagtttcgccgaggcgatcgccgacgagatgagccgg
gtgtga

DBGET integrated database retrieval system