KEGG   Neofusicoccum parvum: UCRNP2_1202Help
Entry
UCRNP2_1202       CDS       T03126                                 

Definition
(GenBank) putative delta-1-pyrroline-5-carboxylate dehydrogenase protein
  KO
K00294  1-pyrroline-5-carboxylate dehydrogenase [EC:1.2.1.88]
Organism
npa  Neofusicoccum parvum
Pathway
npa00250  Alanine, aspartate and glutamate metabolism
npa00330  Arginine and proline metabolism
npa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:npa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    UCRNP2_1202
   00330 Arginine and proline metabolism
    UCRNP2_1202
Enzymes [BR:npa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     UCRNP2_1202
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: EOD52081
UniProt: R1GUT8
Position
Unknown
AA seq 585 aa AA seqDB search
MAASKGGLQSWSQLAKCPRARIDAPQWPARYASRNMGTLATFKVPTVNNEPNQHYAKGSV
DRKKLQEAVERMRKQGPVEIPVFVGGKEIKASAVHTQNNPSSHADPVARFSNATAANVTT
AIDSALEAKPAWESLSFADRAAVFLKAADLIGTKYRYDIMAATMLGQGKNAWQAEIDSAA
ELCDFLRFNVQYAQETLATQPVHHAPGVWNRVEYRPLEGFVYAITPFNFTAIAANLPCAP
ALMGNVVVWKPSPSAMASNWLLYKILLEAGLPPNVIQFVPGDAQEVTKVVLGHREFAALH
FTGSTAVFRSLYGQIASGVADGKYQGYPRIVGETGGKNFHLIHPSANVDNAAKQTVRGAF
EYQGQKCSATSRVYVPKSLWPAFKDIVVAETSALKIGDPSDFSNFCGPVIHEASFKKLSG
VIDEAKNDPELELLVGGKYDGSKGYYIHPTIYATNNPAHPLLSRELFGPVIVVHVYDDAA
PNAFSKICKTIDTTTDYALTGAVFAQDREAIKFAEEALRNSAGNFYVNCKSTGAVVGQQP
FGGARASGTNDKAGSGNLISRFVSMRAIKEEFLPLEKVEYPSNEV
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atggccgcctcaaagggaggtctgcagagctggtcccagctggccaagtgcccacgagcc
cgcatcgacgcgccgcaatggcccgcgcgctatgcctccaggaacatgggcacgctggct
accttcaaggtgcccaccgtcaacaatgagcccaaccaacactatgccaagggctccgtc
gaccgcaagaagctccaggaagccgtggaaaggatgaggaagcagggccctgttgagatc
cccgtcttcgttggaggcaaggagatcaaagcctccgctgttcacacgcagaacaacccc
tcgtctcacgctgatcccgtcgctcgcttctcgaatgccaccgcagccaatgtcacgacc
gcaatcgactctgccctcgaggccaagcccgcctgggagtccctttccttcgctgaccgt
gctgccgtcttcctgaaggctgccgacctgattgggaccaagtacagatacgatatcatg
gcggccacgatgctgggccagggcaagaacgcatggcaggctgagattgactccgctgcc
gagctgtgtgatttcctcaggttcaacgtccagtatgcccaggagacgctcgccacccag
cccgttcaccacgcccctggtgtctggaaccgcgtcgagtaccgcccgctcgagggtttc
gtctacgccatcactccgttcaacttcaccgccatcgccgccaaccttccgtgcgcaccc
gctctgatgggcaacgttgttgtctggaagccgtcgccgtctgctatggcctcaaactgg
ctgctctataagattctgctcgaagctggtctacctcccaacgtcattcagtttgtcccc
ggcgatgctcaggaggtcaccaaggtcgtccttggtcacagggaattcgcagccctccac
ttcactggtagcaccgccgtcttccgcagcctctacggccagattgcctccggtgttgcc
gacggcaagtaccagggctacccacgtatagtcggtgagacgggaggcaagaacttccac
ctgattcacccgtctgccaatgtcgataatgctgccaagcagactgtccgcggtgctttc
gagtaccagggtcagaagtgcagcgccacgtcccgtgtctacgttcccaagtctctctgg
cccgccttcaaggatatcgtcgtcgccgaaacttctgccctgaagattggtgatccctcg
gatttctccaacttctgcggccccgtcatccacgaggcatcgttcaagaagctctctggc
gtcatcgacgaggctaagaacgacccggagctcgagctactcgtcggcggcaagtacgac
ggcagcaagggctactacatccacccgaccatctacgcgaccaacaaccccgcccaccct
cttctcagccgcgagctgttcggtcccgttatcgtcgtccacgtctacgacgatgctgcg
cccaatgctttctccaagatttgcaagaccatcgacaccaccaccgactacgccctcacc
ggcgccgtcttcgctcaggacagagaagccatcaagttcgccgaggaggcgctcaggaac
tccgctggtaacttctatgttaactgcaagagtactggcgccgtcgtgggtcagcagcct
ttcggtggcgcccgtgcttccggcaccaacgacaaggctggcagcggtaacttgatcagc
cgcttcgtcagcatgagggccatcaaagaggagttcctgcccctggagaaggtcgaatac
cctagcaatgaggtgtaa

DBGET integrated database retrieval system