KEGG   Neofusicoccum parvum: UCRNP2_1216Help
Entry
UCRNP2_1216       CDS       T03126                                 

Definition
(GenBank) putative nadph-cytochrome p450 reductase protein
  KO
K14338  cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
npa  Neofusicoccum parvum
Pathway
npa00071  Fatty acid degradation
npa00380  Tryptophan metabolism
Brite
KEGG Orthology (KO) [BR:npa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    UCRNP2_1216
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    UCRNP2_1216
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:npa00199]
    UCRNP2_1216
Enzymes [BR:npa01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     UCRNP2_1216
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     UCRNP2_1216
Cytochrome P450 [BR:npa00199]
 Cytochrome P450, bacteria type
  CYP102 family
   UCRNP2_1216
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450 FAD_binding_1 Flavodoxin_1 NAD_binding_1
Motif
Other DBs
NCBI-ProteinID: EOD51987
UniProt: R1EWM9
Position
Unknown
AA seq 941 aa AA seqDB search
MATQTEELMEIPGPAGLPIVGNLWNIDLDSPLSSLIRICREYGPICQITVGGNKKLLVGS
HAILDELCDEKRFHKAVTGGVGKLRHLTEDGLFTAYHDQHTWGIAHRILMPVFGPMKIRE
MFPEMKDVAVQLCLKWARYGPEHAIAVTDDFTRLTLDTIALCSMDLRFNSFYKDQMHPFV
DSMNEVLKEAGVQAQIPDLLNHTLRRGSVSSFHASIATMRATAADLIARRRAHPVATPDL
LNTLLHGRDPVTGEGLADSAIIDQLITFLVAGHETTSGLLSFAFYYLAAHPRCLAAARAE
VDAVVGAGPIAVEHLARLPYLTAVLRETLRLQPTAPGFELSPFADTVVGGKYKISKDDVL
LAILPAAHRDPAVWGPDADAFVPERMLDEAFERLPRNAWKPFGTGARACIGRAFAWQEAL
LVAAMVLQCFDVEMVDPAYELRVKDSLTIKPDGFEMGWAAAPIATLDSAVEKLPTGQPVV
VITASYDGEPADNAAEFVKWLEGLEGEPLKDVEYAVFGCGHRDWQATFHRIPKLIDDLLE
KAGAKRVATIGTADSAVSDLLSDLDAWQEETLWPALGHETGAGDEADMIKSMLKVEISQP
RRNKIYNNLVEGTVTETCLLTAPGAPVKKHVEILLPPGTTYAPGDHLQVLPVNPRRDVQR
ALARFHLTWDSLVKIGGKKNGVLPAKESIPAGELLGHYVELSQPATPKDLRILAAAATEP
ATKDALTHLAATFSSTTSATRAPSILNLLTSTSATIPSATAIPLPFGTFLSLLPPLRLRT
YSISSSPTHHANHASLTFSVVASHQPADDPASAPPHLGVASNHLADLTHGDIVALALRPT
KPCFHLPADPATPIIMVAAGTGIAPFRGFVQARAAETLLFFGCRAPGVDDLYRDELDRLE
AAGAVQVRRAYSRVEEGRALGPAEARGFGASFHQDLVLSES
NT seq 2826 nt NT seq  +upstreamnt  +downstreamnt
atggctacgcagaccgaggaattgatggaaatcccaggcccggcggggctgcccattgta
gggaatctctggaacatcgatctcgacagcccgctgtcgtccctcatccgaatctgtcgc
gaatatggccccatctgtcagatcactgtcggtggcaacaagaaattgctggtcggaagc
cacgccatcctggacgagctttgcgacgagaaacgcttccacaaggccgttactggcgga
gtgggaaaactgcgacacctgaccgaagacgggctgttcacggcctaccacgatcagcac
acatggggcatcgcgcaccgcatcctcatgccggtcttcgggcccatgaagatcagagag
atgttcccagaaatgaaggacgtggcggtgcagctgtgtctcaagtgggcccgatacgga
ccggagcacgcgatcgccgtcacggacgacttcacgcggctgacgctcgacaccatcgcg
ctctgctcgatggacctccgcttcaacagcttctacaaggaccagatgcacccgttcgtc
gacagcatgaacgaggtgctcaaggaagccggcgtgcaggcccagatcccggacctgctc
aaccacacgctccgccgcggctcggtgtcgtcgttccacgcctcgatcgccaccatgcgc
gccacagcggccgacctgatcgcgaggcggcgcgcgcacccggtcgccacgccggacctg
ctcaacacgctgctgcacggccgcgacccggtgacgggcgagggcctggccgactcggcc
atcatcgaccagctcatcaccttcctggtggccggccacgagaccacctccggcctgctc
tccttcgccttctactacctggccgcgcacccgcgctgcctggccgccgcccgcgccgag
gtcgacgccgtcgtcggcgccggccccatcgccgtcgagcacctcgcccgcctgccctac
ctgaccgccgtgctgcgcgagacgctgcgcctgcagcccaccgccccgggcttcgagctc
agccccttcgccgacacggtcgtcggcgggaagtacaagatctcgaaggacgacgtcctc
ctcgccatcctgcccgccgcccaccgcgaccccgccgtctggggccccgacgccgacgcc
ttcgtccccgagcgcatgctggacgaggcgttcgagcgcctgccccgcaacgcgtggaag
ccgttcggcacgggtgcccgcgcctgcatcggccgcgccttcgcctggcaggaggccctg
ctggtcgcggccatggtgctgcagtgcttcgacgtcgagatggtcgaccccgcgtacgag
ctgcgcgtcaaggactcgctgaccatcaagcccgacgggttcgagatgggctgggccgct
gccccgatcgcgacgctggactcggcggtggagaagctgccgaccggccagccggtcgtg
gtgatcacggcgtcgtatgatggcgagccggctgataatgctgctgagtttgttaagtgg
ttggaggggctggagggtgagccgctgaaggacgttgagtacgctgtgttcggttgcggc
catcgcgactggcaggctaccttccacaggatccccaagttgatcgacgacttgctggag
aaggctggcgccaagagagtagcgacgattgggactgcagactcggcagtgagcgatctg
ctgtccgatcttgatgcatggcaggaggagacgctgtggccagcactgggccatgagacc
ggcgctggagatgaagcggacatgatcaagtccatgctcaaggtggagatctcgcaacct
cgccgcaacaagatctacaacaacctggtcgaaggcaccgtgactgagacctgcctgctg
actgcccccggagccccagtcaagaagcatgttgagattctgcttccgccaggcacgact
tacgcccccggagatcacctgcaggttctcccagtcaaccctcgaagggacgttcaacgc
gcactcgcaaggttccatctgacatgggactcgctggtcaagatcggagggaagaagaac
ggcgtgctgcccgccaaggaatccatcccagccggcgagctactgggccattacgtcgag
ctttcgcagcctgccacgccaaaggacctccgcatcctcgccgccgccgcaaccgaaccg
gccaccaaagatgccctcacccacctcgccgccaccttctcctccaccacctccgccacc
cgcgctccctccatcctcaacctcctcacctccaccagcgccaccatcccctccgcaacc
gccatccccctccccttcggcaccttcctctccctcctccctcccctccgcctgcgcacc
tattccatctcctcctcgcccacccaccacgccaaccacgcctccctcaccttctccgtc
gtcgccagccaccagccagccgacgaccccgccagcgccccgccccacctgggcgtcgcg
tccaaccacctcgccgacctcacccacggcgacatcgtcgccctcgccctccgccccacc
aagccctgcttccacctccccgccgaccccgccacccccatcatcatggtcgccgccggc
accggcatcgcccccttcaggggcttcgtgcaggcgcgcgcggccgagacgctgctgttc
ttcggctgccgcgcgcccggcgtcgacgacctgtaccgggacgagctggaccggctggag
gcggcgggcgcggtgcaggtgcggagggcgtacagtcgggtcgaggagggcagggcgctg
ggccccgccgaggcgcgcgggtttggcgccagcttccatcaggatctggtgcttagcgag
agttga

DBGET integrated database retrieval system