KEGG   Neofusicoccum parvum: UCRNP2_1294
Entry
UCRNP2_1294       CDS       T03126                                 

Definition
(GenBank) putative nitrite reductase protein
  KO
K17877  nitrite reductase (NAD(P)H) [EC:1.7.1.4]
Organism
npa  Neofusicoccum parvum
Pathway
npa00910  Nitrogen metabolism
npa01100  Metabolic pathways
Module
npa_M00531  Assimilatory nitrate reduction, nitrate => ammonia
npa_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:npa00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    UCRNP2_1294
Enzymes [BR:npa01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.4  nitrite reductase [NAD(P)H]
     UCRNP2_1294
SSDB
Motif
Pfam: Pyr_redox_2 NIR_SIR Pyr_redox Rieske_2 Rieske Fer2_BFD NIR_SIR_ferr Rubredoxin_C NAD_binding_9
Other DBs
NCBI-ProteinID: EOD51915
UniProt: R1GJR7
Position
Unknown
AA seq 1125 aa
MSNSEWNDPEANRLPEKVEELRQADGLPDGDGARRKRVVVVGLGMVGIAFIEKLMKYDVK
RREYDVVVIGEEPHLAYNRVGLTSFFQHRQVENLYLNPREWYSSMPEGSLNYHLNAKVTE
VVQAEKVVRTASGETVPYDILVLATGSDALLPRHTPGHDANGVFVYRTIDDLERLIKFAS
TKKGTAGAVVGGGLLGLEAAKAMMDLEDFGKVKLIERNRWVLSRQLDGDAGGMVVEQVRA
LGLDVLLSKRVGEILVDEENSVKGVRFEDGEEMDCTCICFAIGIKARDELARQAGIRCAD
RGGGVIVADNLQTSAPDVYAIGECASWENQTFGLIAPGVEMADVLAFNLTQAKAHSFRKF
KRPDLSTKLKLLGVEVASFGDFFADRDGPKELPARRGGGKKEGVIDSKDRVKTLTEGPAP
PPVKALTYKDPFQQVYKKYLFTLDGKYLLGGMMIGDTKDYVKLVPMVKNQKPLEVPPSEL
IVGSKKGDDEGADDLTDDTQICSCHNVTKGDVVKQVKDGTCKSIGDVKSCTKAGTGCGGC
MPLVQTIFNKTMASMGQEVKNHLCPHFEYSRADLFNIVYVKKLQSFAEVAKSCSKDPDTV
GCEACKPAIGSILASLFNKHIVDTPHRGLQDTNDKFLANIQRNGTFSVVPRVSGGEITAE
KLIIIGTVAKKYNLYCKITGGQRIDMFGAKKQDLLAIWEELIDGGMESGHAYAKSLRTVK
SCVGTTWCRFGIGDSVGMAVRLEERYKSIRGPHKIKGGVSGCVRECAEAQNKDFGLIATE
KGFNIFVGGNGGAKPRHSELLAKDVPPDDVIPILDRYLSFYIRTADKLQRTARWIENLPG
GIKYLREVILEDKLGIAADLEQQMADLVGSFFCEWTEVVKNPAKRALFSQFGNTAETVAP
PVDPVVERGQTRPAYWPKESAKEDFRGHQWSGLAWQPVIEAAQFKDTPAGDSRAVKRGDT
QLAVFKVKGAYYCSQQMCPHKRAFVLADGLVGDDAATGKLWVSCPYHKRNYNLKGEAAGS
CANDSDVSIATFPVEERDDGWVYVKLPPVEELDALLGTEKWRVRKEESVDPFESLDRKLE
RAREAKGSKGRKLSEKSHLENGLGEVAKARQILAGGERGSGGLDW
NT seq 3378 nt   +upstreamnt  +downstreamnt
atgagcaacagcgagtggaacgacccggaggccaaccggctgccggagaaggtggaggag
ctgcggcaggcggacggcctgccggacggagatggcgcgcgcaggaagagggtcgtggtg
gtggggctgggcatggtcggcatcgcgtttatagaaaagctcatgaagtacgacgtcaag
cgccgcgagtacgacgtcgtggtcatcggcgaggagccgcatctggcgtacaaccgcgtg
ggcctgacgagcttcttccagcacaggcaggtcgagaacctgtacctgaacccgagggaa
tggtactcgagcatgcccgagggctccctcaactaccacctcaacgccaaggttaccgag
gttgtccaggcggagaaggtcgtgagaacggcctccggcgagactgtgccctatgacatc
ctcgtcctcgcgaccggctcggatgcgctgctgccgaggcacacgccggggcacgatgcg
aatggagtctttgtgtatcgcaccatcgatgacctagaacggctgatcaagttcgccagc
acgaagaaagggacggcgggtgcggtggtgggcggtggcttgttgggtctggaggcggcg
aaggcgatgatggatctggaggactttgggaaggtgaagttgatcgagaggaatcggtgg
gtcctgtcaaggcaactggacggcgatgcgggaggcatggtggtggagcaggtccgggcg
ctgggactggatgtgctgctcagcaagagggtgggcgaaatccttgtcgatgaggagaat
tcggtcaagggcgtgagatttgaggatggggaggagatggattgcacatgcatttgcttt
gcgattggcatcaaagctcgcgacgagctggcacggcaagccggcatcaggtgcgcggac
aggggaggcggcgtcatcgtcgcagacaacctgcaaacatctgctccagacgtctatgcc
atcggcgagtgcgcgagctgggagaaccagactttcggtctcatcgctcctggtgtcgaa
atggccgacgtcctcgccttcaacctcacccaagcaaaagcccactcattccgaaaattc
aagcggcccgatctgagcaccaagctgaagctcttgggagtcgaggttgccagctttggt
gacttctttgccgaccgcgacggccccaaagagctccctgcgcgaagaggaggcgggaag
aaggagggcgtcatcgattcgaaggacagggtcaagaccctcaccgagggccctgcgcct
cctccagtcaaggcgctgacgtacaaggatccgttccagcaggtctacaagaagtatctg
ttcacgctggatggaaagtaccttctgggtggcatgatgatcggagatacaaaggactac
gtcaagctggtgccgatggtgaaaaatcaaaagccactcgaggttcccccgagcgagttg
atcgtcgggtcaaagaagggtgatgatgagggtgccgacgatctcaccgatgacactcag
atctgctcttgccacaatgtcacgaaaggcgacgttgttaagcaggtcaaggacggcaca
tgcaagagcatcggcgacgtcaagtcctgtacgaaggccggcactggctgcggtggctgt
atgccgctcgtccagaccatcttcaacaaaaccatggcttccatgggccaggaggtcaag
aaccacctttgcccgcactttgaatactcgcgcgccgatctgttcaatatcgtctacgtc
aaaaagctgcagagcttcgcagaagtggccaagtcctgcagcaaagacccggacaccgta
ggctgcgaagcctgcaagcctgccatcgggtccattctggcgtcactcttcaacaaacac
atcgttgatactcctcaccgaggtctccaggacaccaacgacaagttcctggccaacatc
cagcgcaacggcacgttctcggttgttcctcgtgtctctgggggcgagatcactgccgag
aaactgatcatcatcggcacggtggcaaagaagtacaatctgtactgcaagatcaccggc
ggccagagaatcgacatgttcggggccaagaagcaggacctgctggccatctgggaggag
ctgatcgacggcggcatggagagcgggcacgcgtacgccaagtcgctccgcacggtcaag
agctgcgtgggcacgacgtggtgccggttcggcatcggcgacagcgtgggcatggcggtg
cggctggaggagcggtacaagagcatccgcgggccgcacaagatcaagggcggcgtcagc
gggtgcgtgcgcgagtgcgccgaggcgcagaacaaggacttcgggctgatcgccacggag
aagggcttcaacatcttcgtgggcggcaacggcggcgcgaagccgcgccactcggagctg
ctggccaaggacgtgccgcccgacgacgtgatccccatcctcgaccgctacctcagcttc
tacatccgcaccgccgacaagctgcagcgcacggcgcgctggatcgagaacctgcccggc
ggcatcaagtacctgcgcgaggtcatcctggaggacaagctgggcatcgccgccgacctg
gagcagcagatggccgacctggtcggctcgttcttctgcgagtggaccgaagtcgtcaag
aacccggccaagcgcgcgctcttctcgcagttcggcaacacggccgaaaccgtcgcgccg
cccgtcgaccccgtcgtcgagcgcggccagacgcgcccggcgtactggcccaaggagtcc
gcgaaggaggacttccgcggccaccagtggagcgggctcgcgtggcagcccgtcatcgag
gcggcgcagttcaaggacacgcccgcgggcgactcgcgcgccgtcaagcgcggcgacacg
cagctcgccgtgttcaaggtcaagggcgcctactactgctcgcagcagatgtgcccgcac
aagcgcgccttcgtgctcgccgacgggctcgtcggcgacgacgcggccaccggcaagctg
tgggtcagctgcccctaccacaagcgcaactacaacctcaagggcgaggccgccggctcg
tgcgccaacgactcggacgtcagcatcgcgaccttcccggtcgaggagcgcgacgacggc
tgggtgtacgtcaagctgccgccggtcgaggagctggacgcgctgctggggacggagaag
tggagggtgaggaaggaggagagcgtggatccgtttgagagcttggatcgaaagctggag
agggcgcgggaggcgaaggggagcaagggcaggaagctgagcgagaagagccacctggag
aacgggctgggcgaggtggcgaaggcgaggcagatcttggccggcggggagagggggtcg
ggtgggctggattggtag

DBGET integrated database retrieval system