KEGG   Neofusicoccum parvum: UCRNP2_1314Help
Entry
UCRNP2_1314       CDS       T03126                                 

Definition
(GenBank) putative calcium calmodulin-dependent protein kinase protein
  KO
K08794  calcium/calmodulin-dependent protein kinase I [EC:2.7.11.17]
Organism
npa  Neofusicoccum parvum
Brite
KEGG Orthology (KO) [BR:npa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:npa01001]
    UCRNP2_1314
Enzymes [BR:npa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     UCRNP2_1314
Protein kinases [BR:npa01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   UCRNP2_1314
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like YrbL-PhoP_reg Pkinase_fungal Kdo TetR_C_27
Motif
Other DBs
NCBI-ProteinID: EOD51897
UniProt: R1EWB8
Position
Unknown
AA seq 406 aa AA seqDB search
MSLSGMLNKLHGQPDSYDKKSKYRFGKTLGAGTYGIVREADCPEGKVAVKIILKKNVKGN
EQMVYDELEMLQRLKHPHIVRFHDWFESRDKYYIVTQLATGGELFDRICEKGRFTEKDAA
ETIRQVLDAVNYLHQNNVVHRDLKPENLLYLTSAEDSSLVLADFGIAKMLDSPDEQLTTM
AGSFGYAAPEVMLKRGHGKPVDMWSMGVITYTLLCGYSPFRSESLADLIEECKNGRVVFH
ERYWKEVSKDAKDFINSLLQPEPENRATSAEALAHPWLKGETASDHNLLPEIRAYVAKAR
LRRGIELVKLANRIEALKMQEDEEEDVPGEADVPANAQEAAGEALAQHSTNRSLNVQDSA
SGGPHKRSLSKIAKGAIFREVVLAKVREMKEEEERKKFEADAASKH
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgagtctttcaggcatgcttaacaagctgcacggccagcccgacagctacgacaagaag
tccaagtatcgctttggcaagacccttggtgctggcacatacggcattgtccgcgaggcg
gactgccctgagggcaaggtcgccgtgaaaatcatcctcaagaagaacgtcaagggcaat
gagcagatggtctacgatgagctggagatgcttcagcgcctgaagcacccgcacatcgtc
cgtttccatgactggttcgagtcgagggacaaatactacattgtcactcagcttgccacc
ggaggagagctgttcgaccgcatctgcgaaaagggcagattcaccgagaaggatgcggct
gagaccatccgccaggttttggacgctgtcaactacctccaccagaacaatgtcgtccac
agggacctcaagcctgagaatttgctctacctcacctccgccgaggattcgtctctcgtg
ctcgccgatttcggtatcgcgaagatgctcgactcgcccgacgagcagctcaccaccatg
gctggctcctttggctacgcagccccggaggtcatgctcaagcgcggacacggcaagccc
gtcgacatgtggtcgatgggtgtcattacctatactctcctttgcggttactctcccttc
cggagcgagagcctggcagacttgattgaggagtgcaagaacggacgcgttgtcttccac
gagcggtattggaaggaggtcagcaaggatgccaaggacttcatcaacagccttctgcag
cccgagcctgagaatcgtgccacgagcgcggaagctctcgcacacccgtggctcaagggc
gagaccgcctcggaccacaacttgctgcccgagatccgtgcctacgtggccaaggcgcgt
ctccgccgcggtatcgagctcgtcaagctcgccaaccgtatcgaggcactcaagatgcag
gaggacgaagaggaggatgtgcctggcgaggcggacgtgccggcaaacgcgcaggaggcg
gctggcgaggcgcttgcgcaacactcaacgaaccgcagcctgaacgtgcaggactcggcg
tcgggcgggccgcacaagaggagtctgagcaagattgccaagggcgccatcttccgggaa
gtcgtgctcgcaaaggtccgcgagatgaaggaggaagaagagcggaagaagttcgaggcc
gacgcggcgagcaagcactga

DBGET integrated database retrieval system