KEGG   Neofusicoccum parvum: UCRNP2_1438Help
Entry
UCRNP2_1438       CDS       T03126                                 

Definition
(GenBank) putative nuclear import and export protein
  KO
K14289  exportin-5
Organism
npa  Neofusicoccum parvum
Pathway
npa03013  RNA transport
Brite
KEGG Orthology (KO) [BR:npa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    UCRNP2_1438
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:npa03016]
    UCRNP2_1438
   03036 Chromosome and associated proteins [BR:npa03036]
    UCRNP2_1438
Transfer RNA biogenesis [BR:npa03016]
 Eukaryotic type
  tRNA transport factors
   tRNA export factors
    UCRNP2_1438
Chromosome and associated proteins [BR:npa03036]
 Eukaryotic type
  Gene silencing
   microRNA pathway
    Other miRNA pathway proteins
     UCRNP2_1438
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Xpo1 IBN_N
Motif
Other DBs
NCBI-ProteinID: EOD51787
UniProt: R1EVZ8
Position
Unknown
AA seq 1199 aa AA seqDB search
MDGFQANGSAAHAQEQSPADFSRMLEALEAIFDPRSSNSTRQDASAYLEQVKQHRDAPAY
GFQLALDQSHPVHLRYYGLTVLEYSIKYGWEDFSAEQAQAMREWVIQLADGASQQGPVYV
RNKIGQLWAEVAKRSWGTEWMDMDEQLVRLWASSLEHQGLVLYILETLAEDVFNREDPVA
SLRGNELGKACVSIFTPIAVIHDELPGRDPNLDVRYGDEGWVKRVCELLDWCLANNAEKD
ENVCQIAVKALNTLRAAMPWLIPKAIVATESVNHIGRALSVPVVPLQTAAIEALFAIYAR
TNFQDHDFIHIVCPMFGSQIISLLAEIYQWTSNSLDVNDLDEPKYTLSKKLSELLSNLGS
FVEAKPSLIPEGSDIPAFLQLIYEILGHPSLVVSIPVLHAWTRLLRTRSIRDSEAVLRLV
PALLETCSSRLVRYEALPEDSTDPTFILLNEDLDTAPERHAFLGNYRRYCVDIVEVIVRK
MPLDAMQYILGQATSLFSNLYDGFAPFSTQTFAKNSPPVLRADAQITVIDAALKGYLKWI
AGHGSEPQEDDDNRKVMQDAFEEWCKSVLTVRFEDPEINRKIIQLMVTFATKALSSRPSF
ALQLLEYILNLPLHDDPSAPAYSEAVKGLEQACTAEIQRLAIAFPDHFLSVYDELEHKIN
DIVNNRLIDERQRMGYTAFLFIIVHRATTIDRDIRETRLKQMMDMVKDGWMNPELGASLS
SFHSFCEMLGLGEITHFFAAHGFDKIPDWAQQQLDAEGQAKQADILSRFQRLPLRITKNL
LGASTEKLRENSQPHAQAFMNIRNWSHLPPEMQVVMKRVLTDRFWQAGISTESRDDFFAR
VSGSKSSYEGFASTVRGTVRQIREVCYYILYGLTRFKDHFYGISDLPAPLSQALFENAQA
LSAHHVSVLLNISTQLIENCPIHLRSQFLPPIISSLFKELDTKISNEWEILNRQISQAGD
QDNLGDEMKNESILRQLTHSAVMLVSLLLEDVRLDSHDRSGSQTKESRMSTFILSTPEIL
EPILVFCKTVIRVRDTRCVTLISRVMRSTMPHLKDHEPVRNYLCCDVLQAAITSLHEPQF
VDAQKDLAALIAHIIHIDPQQARDIVLSLPGLSTRPDKVDKAFTHIQAVPSERQQRGIVL
DLLSSVRGVSIHEQGKMSLSRPHQHKKAAVQEQYMTVEQQPTIKRGGSPELAGMADMFG
NT seq 3600 nt NT seq  +upstreamnt  +downstreamnt
atggatggcttccaagcgaacggcagcgcggctcacgcccaggagcagagccccgccgac
ttctcgcgcatgcttgaagccctggaagccattttcgacccgcgttcgtccaactccacg
cgccaggacgcctccgcatacctcgagcaggtgaagcagcaccgcgacgcccctgcctac
ggtttccagctcgccctcgatcagtcgcaccccgtgcatctccgctactacggcctcacc
gtgctggaatactcgatcaagtatggctgggaggacttcagcgcagagcaggcccaggcc
atgcgcgagtgggtcatccagctcgccgatggcgcgtcccagcagggccctgtctatgtg
aggaacaagatcggtcagctgtgggccgaggtggctaagaggagctggggcacggagtgg
atggacatggacgagcagctggtgcggctgtgggcgtcgtcgctggagcatcaaggcttg
gtcttgtacatactcgaaaccctcgccgaggacgtcttcaacagagaggaccccgtcgcc
agcctgcgcggcaacgagctgggcaaggcttgtgtcagcatcttcacccccatcgccgtc
atccacgacgagctgcccggtcgcgaccccaacctggacgtcaggtacggcgacgagggc
tgggtcaagcgcgtctgcgagctgctcgactggtgtctggccaacaatgccgagaaagac
gagaacgtctgccaaatcgccgtcaaggctctgaacaccctgcgcgccgccatgccgtgg
ctgatccccaaagcaatcgttgcaaccgagagcgtcaaccacatcggaagagctctgtca
gtgcctgtcgtccctctgcaaacggctgccatcgaggctctgtttgccatctacgcacgt
accaatttccaggaccacgacttcattcacatcgtatgccccatgttcggctcgcagatc
atcagtcttctggccgagatatatcaatggacatcaaacagcttagatgtcaacgacctg
gatgagccaaagtacaccctatcaaagaagctctcagagttgctctcaaatctaggcagc
tttgtagaggccaagccatctcttatccctgagggcagcgatatccccgcattcctccag
cttatatacgagattcttggtcaccctagcctcgtagtttccatccctgtcctgcacgcc
tggacgagactgctacgtactcgctccatcagggactccgaagcagttcttcgcctagtc
cccgccctactagagacgtgcagctcccgcttagttcgctacgaagcgctgcccgaggac
tcgaccgatccgacattcatacttctgaacgaggatctagacaccgcgccagagaggcac
gccttcctcggaaactaccgtaggtattgcgttgatatcgtagaggtcattgtccgcaag
atgcccctggatgcgatgcagtacattcttggtcaagccaccagcttgttttccaatctc
tatgacggcttcgctcctttctcaacgcaaacatttgccaagaactcgccgcctgtcctt
cgagcagacgcgcagataactgtcattgatgctgctctgaagggctacttgaaatggatt
gccgggcacggatcagaacctcaagaggatgatgacaacaggaaggttatgcaggatgcc
ttcgaggagtggtgtaaaagtgtcctcaccgttcgatttgaggatcccgaaatcaatagg
aagatcatccagctcatggttacgttcgccaccaaggcgctttcctcaaggccgagtttt
gccctgcagttgctcgagtatatcctcaatctgcccctgcacgacgatccctcagcaccc
gcttactccgaagctgtcaagggcttggagcaagcatgcacagcggagattcagagatta
gccatcgccttccccgaccacttcctatccgtatatgacgagctggaacacaagatcaac
gatatcgtgaacaaccgcctgattgacgagcggcaacgtatgggctacactgccttcctc
ttcatcatcgtccaccgcgccacaacgatcgatcgcgatattcgggaaacccgcttaaaa
cagatgatggacatggtcaaggatggctggatgaacccggagctgggagcgtcactctct
tcattccattcgttctgcgagatgctcggccttggcgaaatcacacacttctttgctgcg
cacggtttcgacaagattcctgattgggcccaacagcagcttgatgctgaaggccaggcg
aagcaagctgacattctgtctcgtttccagagactgcccctgcgaatcaccaagaatctc
ctcggcgcgtccactgaaaagctgcgcgagaattctcagcctcatgcccaggctttcatg
aatatccgcaactggtctcatctgccgccggagatgcaggtagtcatgaagcgtgtgctt
acagaccggttctggcaggctggtatttcgacagaaagcagggatgacttcttcgcacgc
gtcagtggatccaagtcttcttacgagggattcgcatcgactgtgcgcggaacggtcagg
cagatccgtgaagtctgctactacatcttgtacggtttgaccagatttaaggatcatttc
tacggcatcagcgatcttcctgctccactcagccaggcgttgtttgagaacgcccaagcg
ctttctgctcatcacgtttccgttttactcaacatttccacgcagttgatcgagaactgc
cccattcaccttcgctctcaattccttccgcccatcatttccagtctctttaaggagctc
gacactaaaatcagcaacgagtgggagatactgaacagacagatcagccaggcgggcgat
caagacaaccttggagatgagatgaagaatgaaagcatcctccgccagctcacgcactcg
gccgtgatgctggtatcactccttttggaggatgttcgactcgactcacacgaccgctct
ggcagccagactaaggagtcccgcatgtccaccttcattctatccacgcccgaaatcctc
gagccgatcctcgtgttctgcaaaactgtcatccgcgtccgcgacacgcgctgcgtaacg
ctcatctcccgcgttatgcgtagcaccatgccgcacctcaaagaccacgaacccgtccgc
aactacctctgctgtgacgtcctccaagccgccatcacgtccctccacgagccgcaattc
gtcgacgcgcagaaggacctcgccgccctcatcgcccacatcatccacatcgacccccag
caggcccgcgacatcgtgctgtctctccccggcctctccacccgccccgacaaggtcgac
aaggccttcacccacatccaggccgtgcccagcgagcgccagcagcgcggcatcgtcctg
gacctgctgtcgagcgtgcgcggcgtgagcatccacgagcagggcaagatgagcctgagc
cgcccgcaccagcacaagaaggcggcggtgcaggagcagtacatgacggtcgagcagcag
ccgaccatcaagcgcggcggcagcccggagttggcgggcatggcggacatgttcggttga

DBGET integrated database retrieval system