KEGG   Neofusicoccum parvum: UCRNP2_1762Help
Entry
UCRNP2_1762       CDS       T03126                                 

Definition
(RefSeq) putative protein phosphatase protein
  KO
K18083  myotubularin-related protein 6/7/8 [EC:3.1.3.64 3.1.3.95]
Organism
npa  Neofusicoccum parvum
Pathway
npa00562  Inositol phosphate metabolism
npa01100  Metabolic pathways
npa04070  Phosphatidylinositol signaling system
npa04138  Autophagy - yeast
Brite
KEGG Orthology (KO) [BR:npa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    UCRNP2_1762
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    UCRNP2_1762
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    UCRNP2_1762
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:npa01009]
    UCRNP2_1762
Enzymes [BR:npa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.64  phosphatidylinositol-3-phosphatase
     UCRNP2_1762
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     UCRNP2_1762
Protein phosphatases and associated proteins [BR:npa01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    UCRNP2_1762
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myotub-related GRAM
Motif
Other DBs
NCBI-GeneID: 19020791
NCBI-ProteinID: XP_007581075
UniProt: R1EV55
Position
Unknown
AA seq 181 aa AA seqDB search
MDSRIRVSKVDNVTLWRTGRSVDGTLYLQLHHLVFKYHDPAQSADGSSAAPPARPKEMWV
AYPMISRCTYRPSPSVVHTPPAIRLQCRDFTFFSLHFRKEGEARDAYDTIRCLTCKVGSV
EKLYAFSYKSPEPEKAIGGWKLYDPRREFKRMGISAKDTDKGWRITEINHDYQASPQVEF
T
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atggacagcaggattcgcgtctccaaggttgataatgtcaccctttggcggaccggccgc
agcgtcgacggcaccctgtacttgcagcttcaccacctcgttttcaaataccatgatccg
gcccagtccgccgatggctcctcggccgcgccgccggcgcgtccgaaggagatgtgggtt
gcataccctatgatctcgcgctgtacctaccggccatcgccgtccgtggtgcataccccg
cccgcgatccgcctgcagtgccgcgactttacgtttttctcccttcacttccgaaaggag
ggagaagcgcgcgatgcctacgataccataagatgcctgacttgcaaggtggggagcgtg
gagaagctgtatgctttctcctacaagtcgcctgagcccgagaaggccatcggcggctgg
aagctgtacgacccaaggcgagagttcaagcgcatgggcatcagtgcaaaggacacggac
aaagggtggaggataacagagatcaaccacgattatcaggcaagcccacaagttgagttt
acatga

DBGET integrated database retrieval system