KEGG   Neofusicoccum parvum: UCRNP2_1787Help
Entry
UCRNP2_1787       CDS       T03126                                 

Definition
(RefSeq) putative sucrose-6-phosphate hydrolase protein
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
npa  Neofusicoccum parvum
Pathway
npa00052  Galactose metabolism
npa00500  Starch and sucrose metabolism
npa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:npa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    UCRNP2_1787
   00500 Starch and sucrose metabolism
    UCRNP2_1787
Enzymes [BR:npa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     UCRNP2_1787
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C DUF4975
Motif
Other DBs
NCBI-GeneID: 19020818
NCBI-ProteinID: XP_007581103
UniProt: R1EV14
Position
Unknown
AA seq 590 aa AA seqDB search
MYDQYRDEYHIFYQAFPQHVNFGNTTWGHATSKDLITWTDVNGWKDRSFVAIEPEPAFDY
DWLGDFSGGANAVNLLGEQDGNLTIFYTGARSQPDFWQKPYKPGAETQNAATSSDGGRAW
QKWEGNPILNGAPGGWNVTGLRDPNFSQIPELARILGDDEGTFYITIGSGIRGIGPRAPL
WKAPKDNITDWQFQGSLFEVPLNFTWGDDRNRTGNFGGNFEMATLYPLVEKAEFGGDNQT
IYWAYTFGAEGFESFGHNLTHWSLFALGNVSRRDNGSAEYTIAASGPTDWGNNYAVNTFW
DAKNQRRVAWGWSDEDFNSYGVTQNGYQGSLLLPRELYIRKTRGVVAPTSGPPERSAEIW
EVEEGGKTYCVTTLAQRPLPEVVAGIQGNSNASVGDIVVKGEKKLDGLESYKFHLQATLD
EWPADGQVGFKVRASPNSEEYTTIYYTPSNYTLVLNRISSSLITNFTRSSFNGYFEPYLF
RSATSPSAAPEPITFNIFVDGSLLEIFINDRLSMTSRIYPSRADSLGVSLVSSGGGAVFK
NVTFWDAMAGVWPQRPANTSTQLQYDPYYETHVTIPNEWVPVGYEIYDGY
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atgtatgatcagtaccgcgacgaataccatatcttctaccaggcattcccgcagcacgtc
aactttggcaatacaacctggggccatgctacgtcgaaagatcttatcacgtggactgat
gtcaacggttggaaggaccgcagctttgtcgcaatcgagccggagcctgcatttgactac
gactggcttggagacttctccggcggcgccaatgctgtcaacctgttgggcgagcaggac
gggaacctgacaatcttctacaccggcgcaagatcccaaccggacttctggcaaaagccg
tacaagcctggcgctgagacgcagaatgctgcaacatcaagcgatggcggacgcgcgtgg
cagaagtgggagggcaatccgattctcaacggcgcaccgggaggctggaacgtgaccggc
ttgcgcgaccccaacttttctcagattccggaactggccaggattctgggcgatgatgag
gggacgttctacatcacaatcggcagcggcatccgcggaattgggccccgagctccgctc
tggaaagcgccaaaggacaacatcaccgactggcagttccaaggctcgttgtttgaagtg
ccgctcaacttcacctggggcgatgaccgtaaccgcacaggcaactttggcgggaacttt
gagatggctacgctctaccctttggttgagaaggcagagttcggaggagacaaccagacc
atctactgggcttacacgtttggcgctgaaggatttgaatcctttgggcacaatctgaca
cattggtcactctttgctctgggaaatgtctcccgcagggataacgggtccgctgagtac
acgatcgcggcatctggccccacggactggggaaacaactacgccgtgaatactttctgg
gacgcgaagaaccagaggcgtgttgcttggggatggtctgacgaagacttcaactcttac
ggcgttactcaaaacggataccaaggctctcttctgctcccacgcgagctctacatccga
aagacgaggggtgttgttgccccgaccagtggccctccagagaggagtgctgagatctgg
gaggttgaggaaggcggcaagacctactgcgtcactaccctggcccagcgccctcttccc
gaagttgttgctggcatccagggcaacagcaacgcctctgttggtgacattgttgtcaag
ggtgagaagaagcttgacggtctcgagagttataagttccacctgcaggccacactcgat
gaatggcccgcagacggccaagtgggcttcaaggtccgggcctcgcccaatagcgaagag
tacacaaccatttattacacgccatccaactacacgctcgtcctcaaccgcatcagctcg
tccctcatcacgaacttcacccgttcaagcttcaacggctactttgagccttatctcttt
cgctccgccacgtcgccgtcggccgctcctgagcccatcactttcaacatcttcgtcgac
ggctcgctacttgagatcttcatcaacgaccggctctccatgacatcgcgcatttatcct
tcgcgtgcagactctcttggcgtctcgcttgtttcttcaggcggcggcgcagtattcaag
aatgtcactttctgggatgccatggcgggcgtgtggccgcaaaggccggcgaacacgagc
acgcagttgcagtacgacccgtactacgaaacgcacgttacaattccgaatgaatgggtg
ccggtgggatatgaaatctacgacggatattag

DBGET integrated database retrieval system