KEGG   Neofusicoccum parvum: UCRNP2_1980Help
Entry
UCRNP2_1980       CDS       T03126                                 

Definition
(RefSeq) putative glycoside hydrolase family 32 protein
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
npa  Neofusicoccum parvum
Pathway
npa00052  Galactose metabolism
npa00500  Starch and sucrose metabolism
npa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:npa00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    UCRNP2_1980
   00500 Starch and sucrose metabolism
    UCRNP2_1980
Enzymes [BR:npa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     UCRNP2_1980
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 19021029
NCBI-ProteinID: XP_007581291
UniProt: R1GSK1
Position
Unknown
AA seq 563 aa AA seqDB search
MKVSQAAAAGAALFAGANAQSSSSVYVQPTVPTGTPVPGNYTGGLRPQTHFSPPQHFMND
PNGCFVDANGTWHLYYQYNPTGIVAGNQHWGHATSQDLYHWENQQIAIFPPNNVSNIFSG
SAVIDVNNTSGFFPDQDNGVVAIYTLNTPTKQVQEIAYSYDGGYTFIPYDANPVIDSTST
QFRDPKVIWYEDHWVMVIAYSQDFVIGIYTSLDLKEWTHASNFSHHGLLGLQYECPNMVE
VPVNGTDETMYVLTISINPGAPLGGSITEYFPGHFNGTHFTAVDSAARIGDFAKDNYAAQ
FFYGTPSGSAPVSIAWASNWQYTQVAPTGAEGWRSVMSWPRRTYLANIYRVGWTLVQEPY
DPSPVLGAELASNDSLVNASLVVDYSDVASNAIYFAVNVSGLPSSVSNISSTASLNFTAL
SPVSGESVAGGYFFGGDNPFWLDRGKTRGFDNPYFTDKFSVSQLLDPSGTWSLAGVIDRS
ILELFLDRATYSATATFFPVQPLTLFSIRTAGLPEGAKVEVKVWGLESAWAAYENENGTV
VGNVTTGGGAMERRLVYEAGFEA
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtctcccaggccgctgctgctggtgccgctttgtttgccggcgccaatgcccag
agcagctcgagtgtttacgtccagcccaccgtgccaaccgggaccccggtgccaggcaac
tacaccggtggtctgagaccgcagacccatttctcgcccccgcagcatttcatgaatgac
cccaatggctgctttgtcgacgccaatggcacctggcatctgtactaccaatacaacccg
acaggcattgtggctggcaatcagcactggggccatgccacgagccaggatctgtaccac
tgggaaaaccagcagatcgccatcttccctcccaacaatgtctccaacatcttctctggg
tcggctgtcatcgatgtcaacaacacttccggcttcttccctgaccaggataacggcgtt
gtggccatctacaccctgaacacgcccacgaagcaggtccaagagattgcctattcgtac
gatggtggctacaccttcatcccctacgacgccaacccggtcatcgacagcacgtcgact
caattccgcgaccccaaggtcatctggtacgaggaccactgggtcatggtcattgcctac
tcgcaggacttcgtcatcggcatctacacttcgctcgacctcaaggagtggacgcacgcc
tccaacttctcgcaccacggtctgctgggcctgcagtacgagtgtcccaacatggtcgag
gtccccgtgaacggcaccgacgagaccatgtacgtgctcacaatctctatcaacccgggt
gctcccctcggcggctccatcacggaatacttcccgggacacttcaacggaacgcacttc
acagccgtcgactcggccgcccgcattggcgacttcgccaaggacaactacgccgcccag
ttcttctacggcacgccctccggctccgccccggtctccatcgcctgggccagcaactgg
cagtacacgcaagtcgcgccgaccggcgccgaaggctggcgcagcgtgatgtcctggccg
cgccgcacctacctcgccaacatctaccgcgtaggctggacgctggtgcaggagccctac
gacccatcccccgtcctcggcgccgagctcgcgtccaacgactccctcgtcaacgcctcg
ctcgtcgtcgactacagtgacgtcgcctccaacgccatctacttcgccgtcaacgtgtcc
ggcctcccctcctccgtctccaacatctcgtccaccgcctccctcaacttcaccgccctg
tcgcccgtctcgggcgagagcgtggccggcggctacttcttcggcggcgacaaccccttc
tggctcgaccgcggcaagacgcgcggcttcgacaacccctacttcaccgacaagttctcg
gtttcccagctgctcgacccgtccggcacctggtcgctcgccggcgtcatcgatcgctcc
atcctcgagctcttcctcgaccgcgccacctacagcgccaccgccaccttcttccccgtc
cagccgctgacgctgttctccatccggaccgcgggcttgcccgagggcgcgaaggtcgag
gtgaaggtgtgggggttggagagcgcgtgggcggcgtacgagaacgagaatgggacggtg
gtcggaaatgtgacgacgggtggtggggcgatggagaggaggttggtgtatgaggctggg
tttgaggcgtga

DBGET integrated database retrieval system