KEGG   Neofusicoccum parvum: UCRNP2_2304Help
Entry
UCRNP2_2304       CDS       T03126                                 

Definition
(GenBank) putative mannitol-1-phosphate dehydrogenase protein
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
npa  Neofusicoccum parvum
Pathway
npa00051  Fructose and mannose metabolism
npa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:npa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    UCRNP2_2304
Enzymes [BR:npa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     UCRNP2_2304
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh 3HCDH_N UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: EOD50910
UniProt: R1GGX9
Position
Unknown
AA seq 390 aa AA seqDB search
MPSYDKKAIHFGGGNIGRGFVAEFLHKSGYEVVFVDVMDKIINDLNSTKKYTVTEIGDDG
EKTFEIDHYRAINSKYDLDKVIEEIATADVVTCAVGPNILKFIAEPVAKGIESRKLDHPL
AIIACENAINATNTWRGFIEERLSGATKSKLDTKARFANSAIDRIVPHQDPDAGLNVKIE
KFYEWCVELPPFDGVQHPTIDGVHFVDNLEPYIERKLYTVNTSHASAAYYGYNRGKQLIH
DAMQDTEIHDLVRDCLKETAHLIVNKHGISAQEQDDYVEKIVKRISNPALEDDVRRVGRA
PLRKLSRKERFIGPASQLAEMGEKFDNLLGAASMALRFQNVEGDEESFELAKILKENNAK
EATTQITGLEESHPLFPHILKKVEEVQKGD
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgccgagctacgacaagaaggcgattcactttggcggtggcaacatcggacgcggcttc
gttgccgaattcttgcacaagtccggctatgaggtcgtctttgtcgatgttatggacaag
atcatcaacgacctgaacagcaccaagaaatacacggtcacggaaatcggcgacgacggc
gagaagacgttcgagatcgaccactaccgcgccatcaacagcaagtacgacctagacaag
gttattgaggagatcgcaacggcagatgtcgtcacctgcgcagttggccccaatattctc
aagttcattgcggagccggtcgccaagggcattgagtccaggaagcttgaccaccctctc
gccatcattgcgtgtgagaacgcgatcaacgcaaccaacacctggcgcggcttcattgag
gagagactctcgggtgccaccaagagcaagctggacacgaaggcccgcttcgccaactct
gccatcgaccgtatcgtcccgcaccaagaccccgacgctggcctgaacgtcaagatcgag
aagttctacgagtggtgtgtcgagctgcctcccttcgacggcgtccagcaccccacgatc
gatggtgtccacttcgtcgacaaccttgagccttacattgagcgcaagctgtacaccgtc
aacacctctcacgcctcggctgcatactacggctacaaccgtggaaagcagttgattcac
gatgctatgcaggataccgagatccacgacctcgtccgtgactgcctaaaggagactgct
cacctcatcgtcaacaagcacggtatctcggcgcaggaacaggatgactacgtcgagaag
atcgtcaagcgtatctccaaccctgctcttgaggatgacgtcaggcgtgtcggccgtgcc
cctcttcgcaagctgtctcgcaaggagcgcttcattggccctgcatctcagctcgctgag
atgggcgagaagttcgataaccttctaggcgctgcctcaatggcgctccgcttccagaac
gttgagggtgatgaggagagcttcgagctggccaagatcctcaaggaaaacaacgcgaag
gaggcaacgacacagatcactggtctcgaggagtcgcatcctctgttcccgcacattctc
aagaaggtcgaagaggtccagaagggcgattga

DBGET integrated database retrieval system