KEGG   Neofusicoccum parvum: UCRNP2_2492Help
Entry
UCRNP2_2492       CDS       T03126                                 

Definition
(GenBank) putative methionyl-trna synthetase protein
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
npa  Neofusicoccum parvum
Pathway
npa00450  Selenocompound metabolism
npa00970  Aminoacyl-tRNA biosynthesis
npa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:npa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    UCRNP2_2492
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    UCRNP2_2492
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:npa01007]
    UCRNP2_2492
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:npa03016]
    UCRNP2_2492
Enzymes [BR:npa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     UCRNP2_2492
Amino acid related enzymes [BR:npa01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   UCRNP2_2492
Transfer RNA biogenesis [BR:npa03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    UCRNP2_2492
 Prokaryotic type
   Other AARSs
    UCRNP2_2492
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g Laminin_EGF
Motif
Other DBs
NCBI-ProteinID: EOD50796
UniProt: R1GRB2
Position
Unknown
AA seq 672 aa AA seqDB search
MAASQPILPQEGKRNILITSALPYVNNIPHLGNIIGSVLSADVYSRYCKARGYPTLYICG
SDEYGTATETKAIDEGLTPQELCDKYHKIHADVYKWFNIGFDKFGRTPTQQQTDIAQDIF
LKLHKHGYLEEKTTVQPYCEKHGSFLADRFVEGECSICGDPGARGDQCDKCGNLLDPLEP
EPEAKTAASSDEPEPVGEAKATGFLINPRCKLDGASPVKRETKHVYIRLDALKDQIVEWF
KEASTDGKWSANCIQITQSWIDKGLKPRGITRDLKWGTAVPLPGYEDKVMYVWFDACIGY
VSITATYTDEWEKWWKNPDNVQLYQFMGKDNVQFHTIIFPGSQLGTRDNWTKIHHLSTTE
YLNYEDTKFSKSKGVGVFGNNAKDTGIPSDVWRYYLLSRRPETSDSEFKWKDFIDSNNND
LLKNLGNFVNRVIKFVAAKFDSVVPDYTKYTDEYLKSHEDAVNELLKIYTTHLENVKLKA
GLASALHVSALGNKLLQDNKLDNRLFSEEPERCAAVVGMALNHIHLLASLIEPYLPATAR
GGVTDKGEPILGIFQQLNVDTVPEIPEKWTPGAIKPGHKIGKAGYLFTQIKPEKEQEWRE
AYGGEEAQKAKRLEAEKRAAKKAQKEKEKAKKAAKKAAAATGSVESAEKKQEADPAIEKV
TEAMEKADVHTS
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atggccgcctcccagcccatcttgccgcaggagggcaagcgaaatatcctgatcacaagc
gccctgccctacgtcaacaacatcccccatctgggcaacatcatcggctccgtcctgtcc
gccgacgtctactcgcggtactgcaaggcacgcggctacccgaccctctacatttgcggc
tccgacgagtacggcaccgccaccgagaccaaggccatcgacgagggcctcactccgcag
gagctgtgcgacaagtaccacaagatccatgccgacgtgtacaagtggttcaacatcggc
tttgacaagttcggccgcacgcccacccagcagcagaccgatatcgctcaagacattttt
ctgaagctccacaagcacggatacttggaggagaagaccaccgtccagccatactgcgaa
aagcacgggtctttccttgccgaccgcttcgtcgagggcgagtgcagcatttgcggcgat
cctggcgcacgcggcgaccagtgcgataagtgcggcaaccttctcgacccgctcgagccc
gagcctgaggcaaagacggccgcctcttccgacgagcccgagcctgtcggtgaggccaag
gccaccggcttcctgatcaaccctcgctgcaagttggacggcgcctctccggtaaagcga
gagacaaagcatgtctacattcggctggacgcattgaaggatcagattgtcgagtggttc
aaggaggctagtaccgatggcaagtggtccgccaattgcattcagatcacccagtcgtgg
atcgacaagggcctgaagcctcgtgggatcacccgcgacctgaaatggggtaccgccgtt
ccgcttcccggctacgaggacaaggtcatgtatgtgtggtttgacgcatgtatcggctac
gtctccatcaccgccacctacaccgacgagtgggagaagtggtggaagaacccggataac
gtccagctctaccagttcatgggcaaggacaacgtccagttccacaccatcattttcccc
ggctcgcagctcggtacccgcgacaactggacgaaaatccatcatctgtccacgacagaa
tacctcaactacgaggacaccaagttctccaagtccaagggtgttggtgtgttcggcaac
aacgccaaggacaccggcattccctctgacgtgtggagatactacctgctctcgaggcgg
cccgagaccagtgattccgagttcaagtggaaggacttcatcgactccaacaacaacgac
ctgctgaagaacctcggcaacttcgtgaatcgcgtcatcaaattcgttgccgccaagttc
gactccgttgtgcccgactacaccaagtacacggacgagtacctcaagagccacgaggat
gccgttaacgagcttctgaagatttataccactcacctcgagaatgtcaagttgaaggca
ggtcttgcttcggcgctgcatgtttcggccctcggcaacaagctgctgcaagacaacaag
ctggacaacagactcttctctgaggagccggagcgatgcgccgctgttgttggcatggca
ttgaaccacattcacctcctcgccagccttatcgagccatacttgcctgccacggcacgc
ggcggtgtcactgacaagggcgagcccatcttgggtattttccagcagctgaacgtcgac
accgtccccgagatccccgagaagtggactccgggtgcaatcaagcctggccacaagatc
ggcaaggcgggatatctcttcacccagatcaagcctgagaaggagcaggagtggagagag
gcatacggcggcgaggaggcgcagaaggccaagaggcttgaggctgagaagagggcagcc
aagaaggcgcaaaaggagaaggagaaggcgaagaaggcggcgaagaaggctgcagctgca
acgggcagcgtcgagtcggcagaaaagaagcaggaggcggatccggccatcgagaaggtg
acggaggccatggagaaggcggatgtgcacacttcgtag

DBGET integrated database retrieval system