KEGG   Neofusicoccum parvum: UCRNP2_4334Help
Entry
UCRNP2_4334       CDS       T03126                                 

Definition
(RefSeq) putative dihydrolipoamide succinyltransferase protein
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
npa  Neofusicoccum parvum
Pathway
npa00020  Citrate cycle (TCA cycle)
npa00310  Lysine degradation
npa00380  Tryptophan metabolism
npa01100  Metabolic pathways
npa01110  Biosynthesis of secondary metabolites
npa01130  Biosynthesis of antibiotics
npa01200  Carbon metabolism
Module
npa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
npa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:npa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    UCRNP2_4334
  09105 Amino acid metabolism
   00310 Lysine degradation
    UCRNP2_4334
   00380 Tryptophan metabolism
    UCRNP2_4334
Enzymes [BR:npa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     UCRNP2_4334
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh
Motif
Other DBs
NCBI-GeneID: 19023617
NCBI-ProteinID: XP_007583618
UniProt: R1GKT6
Position
Unknown
AA seq 124 aa AA seqDB search
MRTRIAQRLKESQNRAASLTTFNDVDMSALLALRATHRAAVLEKRGARLGLMGAFAKAAA
LALRDVPAVNAAIEGDAVVWRDYVDVSVAVSTPKGLVTPVLRGCERRGLVQMEEGIAALA
EKVG
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgcgcacgcgcatcgcgcagcgcctcaaagaatcccagaaccgcgccgcgtcgctcacg
accttcaacgacgtcgacatgtcggcgctgctggcgctgcgggcgacgcaccgcgcggcg
gtgctcgagaagcgcggcgcgcggctgggcctgatgggcgcgttcgcgaaggcggcggcg
ctggcgctgcgcgacgtgccggccgtgaacgccgcgatcgagggcgacgcggtcgtgtgg
cgcgactacgtggacgtcagcgtcgcggtgagcacgcccaagggcctggtcacaccggtg
ctgaggggctgcgagcggcgggggttggtgcagatggaggaggggattgcggcgttggcg
gagaaggtgggttga

DBGET integrated database retrieval system