KEGG   Neofusicoccum parvum: UCRNP2_7640Help
Entry
UCRNP2_7640       CDS       T03126                                 

Definition
(GenBank) putative l-allo-threonine aldolase protein
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
npa  Neofusicoccum parvum
Pathway
npa00260  Glycine, serine and threonine metabolism
npa01100  Metabolic pathways
npa01110  Biosynthesis of secondary metabolites
npa01130  Biosynthesis of antibiotics
npa01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:npa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    UCRNP2_7640
Enzymes [BR:npa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     UCRNP2_7640
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Beta_elim_lyase Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: EOD45649
UniProt: R1GI54
Position
Unknown
AA seq 383 aa AA seqDB search
MSPHNYYPVTAPSSTSPAAAGVEPSVNHWTHAGPAATDFRSDTITTPTASMLAAIASTTL
GDDVFLEDAVTNALQAHLAQLTGKPAALLVLSGTMGNQVAIRAHLGAPPHSVLCDHRAHI
LRAEAGGVAALCGAQVDGVHPANGAHLTAADVRAHAVLGDDVHGCPTRLVELENTLGGAV
MPLADVREIGAWARENGVLTHLDGARLWEAVAAGAGSLREYCDAVDSVQLCFSKGLGAPI
GSVIVGSEEFIKRSRWIRKSIGGGIRMAGVISAAARTALEETFFGGKLQQTHVLARRLAD
KWESLGGKLSVPTETNMVWLDVKASGVSADDIVKLAAEKGIKTFGTRIVVHYQITEQAIK
GYEEVMETVMKKKATATNGTNGA
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgtcgccacacaactactacccggtcaccgcgccgtcctccaccagcccggccgccgcc
ggcgtcgagccctccgtcaaccactggacgcacgccgggcccgccgccaccgacttccgc
tccgacaccatcacgacgcccacagcctcgatgctcgcggccatcgcctccaccacgctc
ggcgacgacgtgttcctcgaagacgccgtcaccaacgcgctgcaagcgcacctcgcgcag
ctcaccggcaagcccgcggcgctcctcgtgctctcgggcacgatgggcaaccaggtggcc
atccgggcgcacctgggcgcgccgccgcactcggtgctgtgcgaccaccgggcgcacatc
ctgcgggccgaggcgggcggcgtggcggcgctgtgcggcgcccaggtcgacggcgtgcac
ccggccaacggcgcgcacctgacggccgccgacgtgcgcgcccacgccgtgctgggcgac
gacgtgcacggctgcccgacgcgcctggtcgagctcgagaacacgctcggcggcgccgtc
atgccgctggcggacgtgcgtgagatcggggcgtgggcgcgcgagaatggtgtgctgacg
cacctcgacggcgcgaggctgtgggaggcggtggcggcgggcgcggggtcgttgagggag
tactgcgatgcggtggatagcgtgcagctgtgcttcagcaaggggctgggcgcgccgatc
gggagtgttattgtcggcagcgaggagttcatcaagaggagcaggtggatccggaagagc
attggcggcggcatcaggatggccggcgtgatctccgccgccgcccggaccgcgctcgag
gagacgtttttcgggggcaagctgcagcagacccatgtgctggcgaggcggctggcggat
aagtgggagagccttggcgggaagctgagcgtgccgaccgagacgaatatggtgtggttg
gatgttaaggcatcgggggtgagcgctgatgatattgtgaagttggcggccgagaagggc
atcaagactttcgggaccaggattgtggtgcattaccagatcacagagcaggcgatcaag
gggtatgaggaggtcatggagacagtcatgaagaaaaaggccaccgctaccaatggcact
aatggtgcatga

DBGET integrated database retrieval system