KEGG   Neofusicoccum parvum: UCRNP2_9076Help
Entry
UCRNP2_9076       CDS       T03126                                 

Definition
(RefSeq) putative peptidyl-prolyl cis-trans protein
  KO
K10598  peptidyl-prolyl cis-trans isomerase-like 2 [EC:5.2.1.8]
Organism
npa  Neofusicoccum parvum
Pathway
npa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:npa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    UCRNP2_9076
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:npa03041]
    UCRNP2_9076
   03110 Chaperones and folding catalysts [BR:npa03110]
    UCRNP2_9076
   04121 Ubiquitin system [BR:npa04121]
    UCRNP2_9076
Enzymes [BR:npa01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     UCRNP2_9076
Spliceosome [BR:npa03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   U4/U6.U5 tri-snRNP related factors
    UCRNP2_9076
 Complex C
   U4/U6.U5 tri-SnRNP related factors
    UCRNP2_9076
Chaperones and folding catalysts [BR:npa03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    UCRNP2_9076
Ubiquitin system [BR:npa04121]
 Ubiquitin ligases (E3)
  U-box type E3
   UCRNP2_9076
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase Rtf2 U-box
Motif
Other DBs
NCBI-GeneID: 19028833
NCBI-ProteinID: XP_007588312
UniProt: R1E9W1
Position
Unknown
AA seq 565 aa AA seqDB search
MGKGTDKLYITHSEWASEDAYSASFGSGVNRSKAVGASFRRLPFNFCALSLLPFEHPVCT
AQGTIFDLTNIVPWLKKHGTNPVDGQPLKSADLIKLNFAKNDDAEYVDPVTYKVFTDNTH
LVALKTTGNVFAWDTIERLNIKAKNWRDLVSDEEFSRKDIITLQDPQNLESRDLSAFKYI
KDGESNLTEEQEKERASGVNAGALGSSAKVLKAKDAVAKARADREKAAKAKANGGVAAAL
ARARADQSDGSNALHQNKPLPYNAAQYTTGKAAASFTSTGVTPHTSNERALLSDEEYMLK
RGRVKIAGYARMQTSLGELNVELHTEFAPKAVWNFVQLAKKGYYRNISFHRNIRNFMIQG
GDPTGTGRGGQSIWGKNFNDEFEGPNKHDARGILSMANKGKNTNSSQFFITYRAAKHLDN
KHTIFGRVVGGMDALSRLENAPTDSKDRPDPPVMLEDVVVFVDPFEEFQKQKSEKDAKER
EQEEIKKAGGTEDDKTTWTGKRIRGDGSIESGSSAGGVGKYLQAALAEQKASAPEEDEIV
GEWGEAEEPVRKKFKAGGFGNFDNW
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaaggcacagacaagctctacatcacccactccgagtgggcctctgaagacgcc
tactccgccagcttcgggtccggcgtcaaccgatccaaagccgtcggcgcctcgttccgc
cgcctgcccttcaacttttgcgccctctcgctgctgcccttcgagcaccccgtctgcacc
gcccagggcaccatcttcgacctgaccaatattgtgccatggctgaagaagcatggcacg
aaccctgttgacgggcagccgctgaagagcgccgatctcatcaagctcaactttgcgaag
aacgacgacgccgaatacgtggatcccgttacctacaaggtcttcaccgacaacacccac
cttgtcgccctcaagaccaccggcaatgttttcgcctgggacacaatcgagcgtctaaac
atcaaggccaagaactggcgcgacctggtcagcgacgaggagttctcgcgcaaggatata
atcactctgcaggacccacagaacttggagtcgagggatctgagtgctttcaaatacatc
aaagatggcgagagcaacctgacagaggagcaggagaaggagagggcgagtggcgtcaac
gctggtgctctgggtagctcggccaaggtgctgaaggcaaaggatgccgtggcgaaggcc
agggcggatcgcgagaaggcagcgaaagccaaggcaaacggtggagttgctgcagcactt
gcgcgtgcccgcgcggaccagagcgacggttcaaatgcgctgcaccagaacaagccgtta
ccctacaacgccgcgcagtacacaaccggaaaggccgccgcttcttttaccagcacaggc
gtgacgccgcacacatcaaacgagagagcgctgctctccgacgaggagtacatgctcaag
cgcggccgcgtcaagattgccggatacgccaggatgcagactagcttgggagagctcaac
gtcgaattgcacacagagttcgcacccaaggccgtctggaactttgtgcagttggctaag
aagggctactaccgaaacatctccttccaccgcaacatccgcaatttcatgatacagggc
ggcgatcccaccggtactggacgcggtggacaaagcatatggggtaagaacttcaacgac
gagttcgaaggacctaacaagcacgacgcgcgtggaattctcagcatggcaaacaagggc
aagaacaccaactcgagccagttcttcatcacctaccgcgcagcaaagcacctggataac
aagcacaccatctttggacgcgttgtcggtggcatggacgctctgtcgcggctagagaat
gcgccaacagactcgaaggatagacccgacccgcccgtgatgctcgaggatgtggttgtg
tttgtcgacccgttcgaggagtttcagaagcaaaaatcggagaaggatgccaaggagcgt
gagcaggaagagatcaaaaaagcaggtggcacagaggacgacaagacgacatggactggc
aagcgaattcggggtgacgggagtatcgagtcgggcagcagtgccggaggcgttggaaag
tacctccaggcagcactggcagagcagaaggcgagtgcaccagaggaggatgagattgtg
ggcgaatggggcgaggcagaggagccggtgaggaagaagttcaaggctggtggatttggt
aactttgacaactggtag

DBGET integrated database retrieval system