KEGG   Neofusicoccum parvum: UCRNP2_959Help
Entry
UCRNP2_959        CDS       T03126                                 

Definition
(RefSeq) putative adenylosuccinate synthetase protein
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
npa  Neofusicoccum parvum
Pathway
npa00230  Purine metabolism
npa00250  Alanine, aspartate and glutamate metabolism
npa01100  Metabolic pathways
Module
npa_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:npa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    UCRNP2_959
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    UCRNP2_959
Enzymes [BR:npa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     UCRNP2_959
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Adenylsucc_synt
Motif
Other DBs
NCBI-GeneID: 19029400
NCBI-ProteinID: XP_007580284
UniProt: R1EWS9
Position
Unknown
AA seq 421 aa AA seqDB search
MATTVVCGAQWGDEGKGKLVDILCSEATICCRAQGGNNAGHTIVANGVTYDFHILPSGLV
NPKCVNLVGSGCVVHVPSFFKELEALEKHGLDTSDRIFISDRAQVVFDLHQLVDGLEEVE
LGSGFIGTTRKGIGPTYSTKMTRSGLRVCDLFDHDQLAAGLRRMADGYKKRFGDLLKYDV
EDEITRYKEYSEKLKPYVIDQVPLLKSAKAQNANILVEGANALMLDIDAGSYPFVTSSNT
GLGGVLTGLPLGWRSIREVIGVVKAYTTRVGSGPFPTEQLNEYGEKLQVVGREFGVTTGR
KRRCGWLDLVVVRYSHDVNDYTAINLTKLDILDDFDTIKVATAYHYQGEELQSFPANLDI
LAKVDVTYKELPGWKQATTGAKTFNDLPENARKYVLFIEEFTGLKVKYIGTGPGRESMII
R
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggctaccaccgtcgtctgcggcgcgcaatggggtgacgagggcaagggcaagttggtc
gacatcctctgctccgaggccaccatctgctgccgtgcccagggtggaaacaacgccggc
cacaccattgtcgccaatggtgtcacctacgacttccacatcctcccctccggcctcgtc
aatcccaagtgcgtcaacctcgtcggctccggatgcgtcgtccacgtcccctcgttcttc
aaggagcttgaggctctggagaagcacggtctcgacacctccgaccgcattttcatcagc
gaccgtgcccaggtcgtcttcgacctgcaccagctcgtcgacggccttgaggaggtcgag
ctgggctcgggcttcatcggcaccaccaggaagggcattggcccaacctacagcaccaag
atgactcgcagcggcctgcgcgtctgcgatctcttcgaccacgaccagctggccgctggc
ctgcgtcgcatggccgacggctacaagaagagatttggagatctgctgaagtatgacgtg
gaggacgagatcacccgctacaaggaatacagcgagaagctcaagccctacgtcatcgac
caggtcccgctcctgaagtctgcgaaggcccagaacgccaacatcctcgttgagggtgcc
aacgcgctcatgctcgacatcgacgccggaagctaccccttcgttacctcgtcgaacact
ggtctgggcggtgttctcaccggtctccccctcggctggcgctcaatacgtgaggtcatt
ggcgttgtcaaggcctacaccacgcgcgttggcagcggtccgttcccgacggagcagctg
aacgagtatggcgagaagcttcaggtcgtcggccgtgaattcggtgtcaccaccggccgc
aagcgccgctgcggctggctggacctggttgtcgtccgctactctcacgacgtgaacgac
tataccgccatcaacctgaccaagctcgacatcctcgacgacttcgataccatcaaggtc
gccacggcgtaccactaccagggcgaggagctccagagcttccctgctaaccttgacatc
ctcgccaaggtggatgtcacgtacaaggagctccccggctggaagcaggccactacgggc
gccaagacgttcaacgatctgcctgagaacgcgaggaagtatgtcctcttcattgaggaa
tttacaggactcaaggtcaagtacatcggcactggccctggccgtgagagcatgatcatc
aggtaa

DBGET integrated database retrieval system