KEGG   Natrinema pellirubrum: Natpe_0576Help
Entry
Natpe_0576        CDS       T02425                                 

Definition
(GenBank) siroheme synthase, N-terminal domain protein
  KO
K02304  precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:1.3.1.76 4.99.1.4]
Organism
npe  Natrinema pellirubrum
Pathway
npe00860  Porphyrin and chlorophyll metabolism
npe01100  Metabolic pathways
npe01110  Biosynthesis of secondary metabolites
npe01120  Microbial metabolism in diverse environments
Module
npe_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:npe00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Natpe_0576
Enzymes [BR:npe01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     Natpe_0576
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     Natpe_0576
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_7 Sirohm_synth_M NAD_binding_3 Sacchrp_dh_NADP TrkA_N
Motif
Other DBs
NCBI-ProteinID: AGB30502
UniProt: L0JIV3
Position
complement(561733..562386)
Genome map
AA seq 217 aa AA seqDB search
MIPLLHDFTNETVLIFGGGPVGSRKARRFAREARVIVVSPAFADREFGGAERVRAAPDPA
DVPAWLERIEPALVVAATDDAAVNEAVADAARERGALVNRADRSGERDVGSVVVPATVRE
DPVTVAVATGGTAPALSKYLREELEETLSGAGEMARVCGELRAELKARDVPAERRRAIVT
DVVNSPDLWTALRTGTSNCAQVIEDVLGEEHSGGDRT
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgataccgcttttgcacgatttcacgaacgagacggtgctgatcttcggcggcggtccc
gtcgggtcccgaaaggcccggcggttcgcccgcgaggcacgggtgatcgtcgtcagcccg
gccttcgccgatcgcgagttcggcggggccgaacgggtccgagccgcgcccgaccccgcg
gacgtcccggcgtggctcgagcggatcgagcccgcgctggtcgtcgccgcgaccgacgac
gcggcggtcaacgaggccgtcgccgacgcggcccgcgagcggggggcgttggtcaaccgt
gccgatcgctcgggggaacgcgacgtcggcagcgtcgtcgtccccgcgaccgtccgcgag
gacccggtgaccgtcgccgtcgcgaccggcggcaccgcgcccgcactgagcaagtacctt
cgtgaagaactcgaggagacgctttcgggggccggcgagatggcacgggtctgtggcgag
ttgcgggcggaactcaaggcccgcgacgtgccggcggagcgccgccgggcgatcgtcacc
gacgtcgtcaattccccggacctttggacagctttacgtacgggtacttccaactgtgcc
caagtgatcgaggacgtgctcggcgaggaacactcagggggtgatcgaacgtga

DBGET integrated database retrieval system