KEGG   Natrinema pellirubrum: Natpe_0944Help
Entry
Natpe_0944        CDS       T02425                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
npe  Natrinema pellirubrum
Pathway
npe00260  Glycine, serine and threonine metabolism
npe00750  Vitamin B6 metabolism
npe01100  Metabolic pathways
npe01110  Biosynthesis of secondary metabolites
npe01120  Microbial metabolism in diverse environments
npe01230  Biosynthesis of amino acids
Module
npe_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:npe00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Natpe_0944
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Natpe_0944
Enzymes [BR:npe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Natpe_0944
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP DZR Zn-ribbon_8 HypA zf-C2HC5
Motif
Other DBs
NCBI-ProteinID: AGB30858
UniProt: L0JJ49
Position
916332..917525
Genome map
AA seq 397 aa AA seqDB search
METTDAFAGLECVDCGTVIEATAEAHRCPECDGPLDPRYDYDAIDLDRETLEGRPADSQW
RYAELLPFTRETAVTTREGATPLVDCPDLADELGVERVLLKDEGRNPTGSVRDRGASVAV
TAATQSDADDVALPSTGNGGQAAAAYAGRAGLESHAYLPSRSGFTNKAMVNVHGGDMNVV
GGRYGDAVGAFEEALAEHDDWYSLRAFETPYRHEGIKTLFYELVEDLEWDVPDAICYPTG
IGTGIVGLAKAAREFEELGLIDETPALYAAQASGCAPIADAVADGRDDLDPVERPDTICG
ELEIPDPPAGSWVLEALRETDGDAVATDDPDILEAAVRVAQTTGLEPTPSAAAAASGAWE
LADRGAFDGDETVVIVSTGAGNKEADVLRSHLMGQGI
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggagacgactgacgccttcgcggggctcgagtgcgtcgactgcgggaccgtcatcgag
gctaccgccgaggcccaccgatgtcccgagtgtgacggtccgctcgacccgcgctacgat
tacgacgcgatcgacctcgatcgcgagacgctcgagggtcggccggccgactcgcagtgg
cgctacgccgaactgctgccgtttacccgcgaaacggcggtcacgacccgagagggcgcg
acgccgctggtcgactgtcccgacctggccgacgaactcggcgtcgagcgggtcctgctc
aaagacgaaggccggaacccgacgggctcggtccgcgaccgcggcgcgtcggttgcggtc
acggcggcgacccaaagcgacgccgacgatgtcgcgctcccgtcgaccggcaacggcggc
caggccgcggcggcctacgcgggccgggccggcctcgagtcccacgcttacctcccctcg
cgctcgggctttacgaacaaggcgatggtcaacgtccacggcggcgacatgaacgtcgtc
ggcggccgctacggcgacgccgtcggcgcgttcgaagaggcgctcgccgaacacgacgac
tggtactcgctgcgagccttcgagacgccctatcgccacgaggggatcaagacgctgttc
tacgaactcgtcgaagacctcgagtgggacgtgccggacgcgatctgttacccgacgggg
atcgggacggggatcgtcggcctcgccaaggccgcccgcgaattcgaggaactggggctg
atcgacgagacgcccgcactctacgccgcgcaggcctctggctgtgccccgatcgcggac
gccgtcgccgacggccgcgacgacctcgatcccgtcgagcgccccgacaccatctgtggc
gaactcgagattccggacccgccggccggctcgtgggtcctcgaggcgctccgggagacc
gacggcgacgcggtcgcgaccgacgatcccgacatcctcgaggcggccgtgcgggtggcc
cagacgaccggcctcgagccgaccccgagcgcggcggcggccgccagcggcgcgtgggaa
ctcgccgaccgcggtgcgttcgacggcgacgagacggtcgtgatcgtctcgacgggcgcg
ggcaacaaggaggccgacgtgttgcgcagccatctgatgggacagggcatttag

DBGET integrated database retrieval system