KEGG   Natrinema pellirubrum: Natpe_2637Help
Entry
Natpe_2637        CDS       T02425                                 

Definition
(GenBank) succinate dehydrogenase, hydrophobic anchor subunit
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
npe  Natrinema pellirubrum
Pathway
npe00020  Citrate cycle (TCA cycle)
npe00190  Oxidative phosphorylation
npe00650  Butanoate metabolism
npe00720  Carbon fixation pathways in prokaryotes
npe01100  Metabolic pathways
npe01110  Biosynthesis of secondary metabolites
npe01120  Microbial metabolism in diverse environments
npe01130  Biosynthesis of antibiotics
npe01200  Carbon metabolism
Module
npe_M00009  Citrate cycle (TCA cycle, Krebs cycle)
npe_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
npe_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:npe00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Natpe_2637
   00650 Butanoate metabolism
    Natpe_2637
  Energy metabolism
   00190 Oxidative phosphorylation
    Natpe_2637
   00720 Carbon fixation pathways in prokaryotes
    Natpe_2637
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CCB2_CCB4 DUF485
Motif
Other DBs
NCBI-ProteinID: AGB32444
UniProt: L0JMF9
Position
2580183..2580548
Genome map
AA seq 121 aa AA seqDB search
MAERYSSFTPGGTGWFLQRVTAAFLVVVLAFHFFLLHFVNHAYEVSFMGTQARMENIGYF
LTMVLFLVTAAFHGVNGVYNALVNQGLEGTQKKVVLAVLTIAGVGLVAQGTYVALTMSGM
I
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atggcggaacgatactcctcctttacgcccggcggcaccggctggttcctccagcgcgtc
accgccgcgttcctcgtcgtcgttcttgccttccacttcttcctcttgcacttcgtcaac
cacgcgtacgaggtaagcttcatgggcactcaggcccgaatggagaacatcgggtacttc
ctcacgatggtcttgttcctggtgaccgccgccttccacggcgtcaacggcgtctacaac
gccttggtcaatcagggactcgaggggacccagaagaaggtcgtgctggcggtgttgacc
atcgccggcgtcggcctcgtcgcgcagggaacgtacgtcgcactcacgatgtcggggatg
atctaa

DBGET integrated database retrieval system