KEGG   Natronomonas pharaonis: NP_1270AHelp
Entry
NP_1270A          CDS       T00279                                 

Gene name
tp33
Definition
(GenBank) transport protein (probable substrate phosphate/sulfate)
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
nph  Natronomonas pharaonis
Brite
KEGG Orthology (KO) [BR:nph00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    NP_1270A (tp33)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: CAI48726
UniProt: A0A1U7EUQ6
Position
623131..624282
Genome map
AA seq 383 aa AA seqDB search
MELLLLVGILVAVFVGYNIGGATTAPAFGPAVGAGVLSKVAAAALMTVFFLAGGWTLGRE
VVDTLGEGIVPGELFTLEASIVVLFFIGFALFISNSFGVPASTSMTAVGSIAGLGLATGT
LNWVTMGQIVSWWIVAPIIAFWISGVVGRYFYPTINEWVAIPDSEGNPLRGEGSRRERVG
ALVVIGIGCLMAFSSGASNVANAIAPLVGSGELSMNLGIIIATVAVGIGAFTIARKTLDT
MGNDLTELPLTAAIVVAVISSTATAALAAIGIPASFVIIATMSIVGLGWGRATRTTRARD
AVRGEETNVSVGALAADEAATVGDTGPESEQSPPIGEEDPGDIPAASDLFDPKTTGRVIL
MQNVVPAIATLGAFLVFRFVPVV
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggagcttctattgcttgtcggcattctcgtcgccgttttcgtcggctacaacattggc
ggcgcgacgaccgccccggcgttcgggccggcggtcggtgccggcgtcctctcgaaggta
gcggctgcggcgctgatgacggtcttctttctcgctgggggctggacgctcggccgcgaa
gtcgttgatacgcttggagagggtattgtccccggagagctgttcaccttggaggcgagt
atcgtcgtcctgtttttcatcggcttcgcgctgtttatctccaacagcttcggcgtcccc
gcctcgacatcgatgactgcggtcggttctatcgccgggctcgggttggcaactggaacg
ttgaactgggtgacgatgggccagatcgtctcgtggtggattgtcgccccgattatcgcg
ttctggataagcggcgtcgtcggccgctacttctatccgacaatcaacgagtgggtagcg
attcccgactccgaggggaacccgttacgcggcgagggcagccgccgggagcgcgtcggc
gcgctcgtcgtcatcggcatcggctgtctgatggccttctccagcggggcctcgaacgtc
gccaacgctatcgcgccgcttgtcggcagcggcgaactgtcgatgaatctcggcatcatc
atcgcgactgttgcggtgggcatcggtgcgttcacaatcgcacggaagacgctggatacg
atgggcaacgacctcacggaactcccgttgacggccgccatcgtcgtcgccgtcatctct
tcgacagcgacggccgcgctggctgccatcggcatcccggcgtcgtttgtcatcatcgcg
acgatgagcatcgtcggcctcggctggggtcgagcgacacgaacaacgcgcgccagagat
gcggttcgcggcgaagagaccaacgtttccgtcggcgcgctcgcagccgacgaggcggcg
acagtcggcgacaccgggcccgaaagcgagcagtcaccgcccatcggcgaggaggacccc
ggagacatccccgctgcctcggacctgttcgacccgaagacgaccggccgcgttattctg
atgcaaaacgtcgtccctgcaattgccacgctcggcgcatttctcgtctttcggttcgtc
cccgtggtctga

DBGET integrated database retrieval system