KEGG   Novosphingobium pentaromativorans: JI59_10675Help
Entry
JI59_10675        CDS       T03399                                 

Definition
(GenBank) threonine--tRNA ligase
  KO
K01868  threonyl-tRNA synthetase [EC:6.1.1.3]
Organism
npn  Novosphingobium pentaromativorans
Pathway
npn00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:npn00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    JI59_10675
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:npn01007]
    JI59_10675
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:npn03016]
    JI59_10675
Enzymes [BR:npn01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.3  threonine---tRNA ligase
     JI59_10675
Amino acid related enzymes [BR:npn01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   JI59_10675
Transfer RNA biogenesis [BR:npn03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    JI59_10675
 Prokaryotic type
    JI59_10675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2b HGTP_anticodon TGS tRNA_SAD
Motif
Other DBs
NCBI-ProteinID: AIT80208
Position
2225664..2227664
Genome map
AA seq 666 aa AA seqDB search
MSEMFKISLPDGSVREMPLGSTPGDVAAAIGPGLAKAAIAARIDGELVDLTRPFTGDATL
ALVTGRDEEEALELARHDYAHVLAEAVQALWPGTQITFGPATDDGFYYDVMAPASREPFG
MDDLPAIEEKMREIIKADKPLRREVWSRQQLIDKWTAEGETFKAQWAGELPEGEELTVYW
SGDDWLDMCRGPHLPSTGKLDPQAFKLMRVAGAYWRGDQKNAQLTRIYGTGWLNKKQLNA
HLTRLEEAAKRDHRKLGGEMDLFHLQAEAHGSVFWHPKGYVIWRELEAYMRRAIDGAGYK
EVKTPQVMDARQWEQSGHWGKYRENMFVIPDEVPNVEDEGPLVSDDADWMALKPMNCPAH
VLIFRQGIKSYRDLPLRIYENGCCHRNEPHGALHGLMRVRQFTQDDAHIFCREDQIVAEV
QSFCELADRIYKDFGFTYSIKLALRPEKRFGSDEMWDKAEAELRDAVVRAGLASEEYGWE
ELPGEGAFYAPKLEWHLTDAIGRTWQVGTIQSDRVLPERLDASYIAEDGEKHRPVMLHRA
IFGSYERFIGILIEHFAGKLPVWLAPVQAVVATIVSDADDYAKEVTAKLKAAGVRVETDL
RNEKINYKVREHSLKKVPHLLVVGKREADEQTVAVRTLGAEHQKVMSLEDAIAMLKGEAT
APDLRP
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atgtccgagatgttcaagatcagccttcccgatggttccgtgcgcgagatgccgctcggg
tcgacccccggcgacgttgccgccgccatcggccccggcctcgccaaggccgcgattgcc
gcaaggatcgacggtgagctggtcgacctgacccgtcccttcaccggcgatgcgacgctg
gcgctggtcaccggccgcgacgaggaagaggcgctcgaactcgcccgccacgactatgcg
cacgtgctggccgaggcggtgcaggcgctctggcccggcacccagatcactttcggcccc
gcgaccgacgacggcttctactatgacgtgatggctccggcctcgcgcgagcccttcggc
atggacgaccttcccgccatcgaggaaaagatgcgcgagatcatcaaggccgacaagccg
ctgcgccgcgaagtctggagccgccagcagctgatcgacaagtggaccgccgagggcgag
accttcaaggcgcaatgggccggcgaactgcccgagggcgaggaactgaccgtctactgg
tccggcgacgactggctcgacatgtgccgcggcccgcaccttccctcgaccggcaagctc
gaccctcaggccttcaagctgatgcgcgtagccggggcctactggcgcggcgaccagaag
aacgcgcagctgacccgcatctacggcaccggctggctcaacaagaagcagcttaatgcc
caccttacccggctcgaggaagcggccaagcgcgaccaccgcaagctcggcggcgagatg
gacctgttccacctccaggccgaagcgcacggctcggtgttctggcaccccaagggctat
gtgatctggcgcgagcttgaagcctacatgcgccgcgccatcgatggtgccggctacaag
gaggtcaagaccccgcaggtgatggacgcccgccagtgggagcagtccggccactggggc
aagtaccgcgagaacatgttcgtcatccccgacgaagttcccaacgtcgaggacgagggc
ccgctcgtgtccgacgatgcggactggatggcgttgaagccgatgaactgcccggcgcac
gtcctgatcttccgccagggtatcaagtcgtatcgcgacctgccgctgcgcatctacgag
aacggctgctgccaccgcaacgagccgcacggagcattgcacggactgatgcgcgtgcgc
cagttcacccaggacgacgcgcatatcttctgccgcgaagaccagatcgtcgccgaagtg
cagtctttctgcgaactggcggaccggatctacaaggacttcggcttcacgtactcgatc
aagctcgccctgcgccccgaaaagcgcttcggcagcgacgagatgtgggacaaggccgag
gccgagctgcgcgacgcggtcgtgcgcgcagggcttgcgagcgaggaatacggctgggag
gagctgcccggcgaaggcgccttctacgcgcccaagctggaatggcacctcaccgacgcg
atcggccgtacctggcaggtcggcacgatccagtcggaccgcgtcctgcccgaacgcctt
gatgcaagctacatcgccgaggacggcgaaaagcaccgcccggtcatgctgcaccgcgcg
atcttcggctcctatgagcgcttcatcggcatcctcatcgagcactttgccggcaagttg
ccggtctggctcgcgccggtgcaggccgtcgtcgcgacgatcgtttcggatgccgacgac
tatgcgaaggaagtcaccgcgaagctcaaggctgcgggcgtgcgcgtcgaaaccgacctg
cgcaacgagaagatcaactacaaggtgcgcgaacactcgctcaagaaggtcccgcacctg
ctggtcgtgggcaagcgcgaggcggacgagcagaccgtcgccgtgcgtacgctgggtgcc
gagcaccagaaagtaatgagcctcgaggacgccatcgccatgctcaagggcgaagcgacc
gcaccggacttgcgcccttga

DBGET integrated database retrieval system