KEGG   Novosphingobium pentaromativorans: JI59_14040Help
Entry
JI59_14040        CDS       T03399                                 

Definition
(GenBank) phenylalanine-4-hydroxylase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
npn  Novosphingobium pentaromativorans
Pathway
npn00360  Phenylalanine metabolism
npn00400  Phenylalanine, tyrosine and tryptophan biosynthesis
npn00790  Folate biosynthesis
npn01100  Metabolic pathways
npn01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:npn00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    JI59_14040
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    JI59_14040
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    JI59_14040
Enzymes [BR:npn01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     JI59_14040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: AIT80815
UniProt: G6EA42
Position
2926531..2927397
Genome map
AA seq 288 aa AA seqDB search
MKKPSTDTSASGLRGEYEGASDDYTVGQDWHAYTPQMHERWRRLHARQSALTDRYACRSF
REGLARLDCAEGIPRFEDANAILGPATGWQLVAVPGFIPDAVFFDHLAHRRFPVTRWVRE
EHELDYLVEPDVFHDFFGHVPMLLDPAIADFLELYGKAGERAMAMDALPMLARIYWYTIE
FGLVREGDELRVFGAGIISSHSETVYSIDDSGVLRLPFDPVRVMRTGYMIDDFQKTYFVL
ESLPQLIDDLVGLDFGPVYEQWRDAPALPAGESLPGETPYNPKREMTP
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagcccagcacggataccagcgccagcggccttcgtggcgagtacgagggtgcc
tccgacgattataccgtcgggcaggattggcatgcctatacgccccagatgcacgagcgc
tggcggcggcttcatgcgcgccagtcggcactcaccgaccgttatgcatgccgctccttc
cgcgagggtctggcccgtctcgactgcgccgaggggatcccgcgtttcgaggatgccaac
gccatccttggcccggccactggctggcagctcgtcgcggtccccggcttcattcccgat
gcggtgttcttcgatcatctggcccaccgccgctttccggtgacgcgctgggtccgcgag
gagcacgagctcgactatctggtcgagccggacgtgttccacgatttcttcggccacgtg
ccgatgttgcttgatcccgcgatcgccgacttcctcgaactctatggcaaggccggcgag
cgggcgatggcaatggatgcgctgccgatgctggcgcgcatctactggtacacgatcgaa
ttcggcctcgtgcgcgaaggcgatgagctgcgcgtgttcggcgcggggatcatctcctcc
cacagcgagacggtctattcgatcgacgattccggtgtcctgcgcctgccgttcgatccg
gtccgggtcatgcgcactggctacatgatcgacgatttccagaagacctacttcgtgctc
gaaagcctgccccagctcatcgacgacctggtcggcctcgatttcgggcccgtctacgaa
cagtggcgcgatgcgcctgcgctgccggcgggcgaaagcctgcccggcgaaaccccctac
aatccgaaacgcgagatgaccccatga

DBGET integrated database retrieval system