KEGG   Novosphingobium pentaromativorans: JI59_15255Help
Entry
JI59_15255        CDS       T03399                                 

Definition
(GenBank) tryptophan 2,3-dioxygenase
  KO
K00453  tryptophan 2,3-dioxygenase [EC:1.13.11.11]
Organism
npn  Novosphingobium pentaromativorans
Pathway
npn00380  Tryptophan metabolism
npn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:npn00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    JI59_15255
Enzymes [BR:npn01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.11  tryptophan 2,3-dioxygenase
     JI59_15255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_dioxygenase
Motif
Other DBs
NCBI-ProteinID: AIT81039
UniProt: G6E9F3
Position
complement(3175297..3176085)
Genome map
AA seq 262 aa AA seqDB search
MTDMTYARYLALDDLLAAQHPVSDEHDELLFIVIHQTKELWLKQILSELHLAIGLVQRDA
LVEAYKSLARVSRIQSVMTLAWEVLATMTPSDYSTFRPVLGTSSGFQSDQFRTMEFLLGL
KQAGHLEFQADRPHARAAMEQALCQPSLWDEANRALARAGFALPPEALERDFSATYEPSP
QVEAAWLEVYRDPHRHWDLYQLAEKLVDIDDALSTWRHKHVLTVSRIIGGKPGTGGTSGV
PYLASTVTKRAFPELWSLRTSL
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgacagacatgacttacgcgcgctacctggcgctcgacgatcttctcgccgcccagcac
cccgtctccgacgaacacgacgagctgctgttcatcgtcattcaccagaccaaggaactg
tggctcaagcaaatcctgtccgaactgcatcttgccatcgggctggtgcagcgcgacgcc
ctggtcgaagcctacaagagcctcgcccgggtcagccgcatccaatcggtgatgacgctg
gcctgggaagtcctcgcgacgatgacgcccagcgactactcaaccttccgcccggtgctg
ggaaccagttcgggcttccagtccgaccagttccgcacgatggagttcctgctcggcctc
aagcaggcggggcatctcgaattccaggccgaccggccccatgcgcgcgcggcgatggaa
caggcgctgtgtcagccgagcctgtgggacgaggccaatcgcgcgctcgcccgcgccggc
ttcgcgctgccgcccgaagcgcttgagcgcgatttcagcgcgacttacgaaccctcgccc
caggtcgaggcggcatggctggaagtctaccgcgatccgcaccgtcactgggacctctat
cagctcgccgaaaagctggtcgacatcgacgatgccctgtccacctggcgccacaagcac
gtgcttacggtcagccgcatcatcggcggcaagcccggtaccggcgggacatcgggcgtg
ccctatctcgcctcgaccgtgaccaagcgcgccttccccgaactctggtcgctcaggacc
agcctttaa

DBGET integrated database retrieval system